DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11454 and UBP1A

Sequence 1:NP_608497.1 Gene:CG11454 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_849806.1 Gene:UBP1A AraportID:AT1G54080 Length:430 Species:Arabidopsis thaliana

Alignment Length:188 Identity:49/189 (26%)
Similarity:71/189 (38%) Gaps:52/189 (28%)


  Fly    49 NGDQLVG-QLEDDDDEEEDEEQRTLFCGNLDERVTEEILYEVF--LQAGPIEGVRIPTDNNGRPR 110
            ||....| :|.::|..|.:.:..|::.|||...||:..|:.:|  |.||.||.||:..|     :
plant   251 NGSSEDGRELSNEDAPENNPQFTTVYVGNLSPEVTQLDLHRLFYTLGAGVIEEVRVQRD-----K 310

  Fly   111 NFGFVTY----------QRLCAVPFALDLYQGLELFQKKVTIKQQGGKQLPAYNQSRLRNQFMME 165
            .||||.|          |...|.||         ||.:::.. ..|.|..|:...|        .
plant   311 GFGFVRYNTHDEAALAIQMGNAQPF---------LFSRQIRC-SWGNKPTPSGTAS--------N 357

  Fly   166 ALPQPSPLRHARHSLHNGKPYDRNPFGHNADQRRRSDSSVMERNRLKPQQHHQHMQGG 223
            .||.|:|......|..:...|:|.                :...::.||..|...|.|
plant   358 PLPPPAPASVPSLSAMDLLAYERQ----------------LALAKMHPQAQHSLRQAG 399

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:240782 27/86 (31%)
RRM <70..210 CDD:223796 38/152 (25%)
UBP1ANP_849806.1 RRM1_TIA1_like 65..135 CDD:240798
ELAV_HUD_SF 74..331 CDD:273741 28/85 (33%)
RRM2_PUB1 149..227 CDD:241063
RRM3_TIA1_like 273..348 CDD:240800 28/90 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
10.910

Return to query results.
Submit another query.