DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11454 and Rbm7

Sequence 1:NP_608497.1 Gene:CG11454 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_659197.2 Gene:Rbm7 MGIID:1914260 Length:265 Species:Mus musculus

Alignment Length:218 Identity:60/219 (27%)
Similarity:94/219 (43%) Gaps:52/219 (24%)


  Fly    67 EEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDNNGRPRNFGFVTYQRLCAVPFALDLYQ 131
            |..||||.|||:.:||||:|:|:|.||||:..|:||.|.:|:.:.|.||.::...:||:|::|..
Mouse     7 EADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKLKQFAFVNFKHEVSVPYAMNLLN 71

  Fly   132 GLELFQKKVTIKQQGGKQ------LPAYNQSRLRNQFMMEALPQ--------------------P 170
            |::||.:.:.|:.:.|..      ..:|.|..:.|.......|.                    .
Mouse    72 GIKLFGRPIKIQFRSGSSHASQDASVSYPQHHVGNLSPTSTSPNSYERTVGNVSPTAQMVQRSFS 136

  Fly   171 SPLRHARHSLHN------------GKPY--------DRNPFGHNADQ------RRRSDSSVMERN 209
            ||..:.|.::.|            |.|:        ...|.||..:|      |:.:.||..:|.
Mouse   137 SPEDYQRQAVMNSVFRQMSYAGKFGSPHADQLGFSPSAQPHGHTFNQSSSSQWRQDALSSQRKRQ 201

  Fly   210 RLKPQQHHQHMQGGSRRSDQRSN 232
            ...|....:|.....|.||..|:
Mouse   202 NSHPYLADRHYSREQRYSDHGSD 224

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:240782 34/74 (46%)
RRM <70..210 CDD:223796 53/192 (28%)
Rbm7NP_659197.2 RRM <9..>101 CDD:223796 36/92 (39%)
RRM_RBM7 9..83 CDD:241036 34/74 (46%)
ZCCHC8 binding. {ECO:0000250|UniProtKB:Q9Y580} 25..35 6/10 (60%)
ZCCHC8 binding. {ECO:0000250|UniProtKB:Q9Y580} 59..76 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C273156048
eggNOG 1 0.900 E1_KOG4454
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D491103at33208
OrthoFinder 1 1.000 FOG0002003
OrthoInspector 1 1.000 T616779
orthoMCL 1 0.900 OOG5_135149
Panther 1 1.100 O PTHR13798
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5568
TreeFam 1 0.960
1110.740

Return to query results.
Submit another query.