DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11454 and rbm7

Sequence 1:NP_608497.1 Gene:CG11454 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_956219.1 Gene:rbm7 ZFINID:ZDB-GENE-030131-6724 Length:252 Species:Danio rerio

Alignment Length:248 Identity:72/249 (29%)
Similarity:106/249 (43%) Gaps:86/249 (35%)


  Fly    66 DEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDNNGRPRNFGFVTYQRLCAVPFALDLY 130
            ||..||||.||||.:||||:::|:||||||:..|:||.:|.|:.:.|.||.::...:||:||:|.
Zfish     5 DEADRTLFVGNLDPQVTEEVIFELFLQAGPLIKVKIPKNNEGKSKLFAFVNFKHEVSVPYALNLL 69

  Fly   131 QGLELFQKKVTIK----------------------------QQGGK----------------QLP 151
            .|:.|..:::.||                            .:||:                |.|
Zfish    70 NGIRLHGRQLNIKFKTGSSHINQEGKSPANSQNPSPANTPGHRGGRTPEQMGSPSYSPPQHMQRP 134

  Fly   152 AYNQSRLRNQFMM-------------------EALPQP--------SPLRHARHSLHNGKPYDRN 189
            ..:...|:.|.||                   :.:.||        |..|..|||     |.|.|
Zfish   135 FSSPDTLQRQAMMNNMWQVQMQQLQMLSGTFQQGMQQPRGNADGGWSGHRGQRHS-----PQDNN 194

  Fly   190 PFGHNA-DQRRRSDSSVMERNRLKPQQ----HHQHMQGGSRRS---DQRSNNK 234
              .|.. |||..:.::..||||...|:    ||....||..|:   |:|.:::
Zfish   195 --NHQGRDQRHGNGANNYERNRRDGQRGDFYHHDDRSGGHNRNYPPDRRRDSR 245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:240782 35/74 (47%)
RRM <70..210 CDD:223796 61/212 (29%)
rbm7NP_956219.1 RRM <8..150 CDD:223796 44/142 (31%)
RRM_SF 8..82 CDD:302621 35/74 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C273152945
eggNOG 1 0.900 E1_KOG4454
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1298240at2759
OrthoFinder 1 1.000 FOG0002003
OrthoInspector 1 1.000 T1053868
orthoMCL 1 0.900 OOG5_135149
Panther 1 1.100 O PTHR13798
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5568
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.