| Sequence 1: | NP_608497.1 | Gene: | CG11454 / 33175 | FlyBaseID: | FBgn0031224 | Length: | 238 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_956219.1 | Gene: | rbm7 / 334784 | ZFINID: | ZDB-GENE-030131-6724 | Length: | 252 | Species: | Danio rerio | 
| Alignment Length: | 248 | Identity: | 72/248 - (29%) | 
|---|---|---|---|
| Similarity: | 106/248 - (42%) | Gaps: | 86/248 - (34%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly    66 DEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDNNGRPRNFGFVTYQRLCAVPFALDLY 130 
  Fly   131 QGLELFQKKVTIK----------------------------QQGGK----------------QLP 151 
  Fly   152 AYNQSRLRNQFMM-------------------EALPQP--------SPLRHARHSLHNGKPYDRN 189 
  Fly   190 PFGHNA-DQRRRSDSSVMERNRLKPQQ----HHQHMQGGSRRS---DQRSNNK 234  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG11454 | NP_608497.1 | RRM_RBM7_like | 69..143 | CDD:240782 | 34/73 (47%) | 
| RRM | <70..210 | CDD:223796 | 60/211 (28%) | ||
| rbm7 | NP_956219.1 | RRM | <8..150 | CDD:223796 | 44/141 (31%) | 
| RRM_SF | 8..82 | CDD:302621 | 34/73 (47%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 88..137 | 4/48 (8%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 171..252 | 26/82 (32%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C170594806 | |
| Domainoid | 1 | 1.000 | 75 | 1.000 | Domainoid score | I9052 | 
| eggNOG | 1 | 0.900 | - | - | E1_KOG4454 | |
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1298240at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0003483 | |
| OrthoInspector | 1 | 1.000 | - | - | oto39220 | |
| orthoMCL | 1 | 0.900 | - | - | OOG6_108583 | |
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R5568 | 
| SonicParanoid | 1 | 1.000 | - | - | X2850 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 12 | 11.640 | |||||