DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11454 and Spx

Sequence 1:NP_608497.1 Gene:CG11454 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_511058.1 Gene:Spx FlyBaseID:FBgn0015818 Length:347 Species:Drosophila melanogaster

Alignment Length:86 Identity:23/87 (26%)
Similarity:47/87 (54%) Gaps:1/87 (1%)


  Fly    65 EDEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDN-NGRPRNFGFVTYQRLCAVPFALD 128
            |..:..|::.|.||::|:|.:|:|:|:||||:..|.:|.|. ....:.:|||.:.......:.:.
  Fly     8 ERNQDATIYAGGLDDKVSETLLWELFVQAGPVVNVHMPKDRVTQMHQGYGFVEFLSEEDADYGIK 72

  Fly   129 LYQGLELFQKKVTIKQQGGKQ 149
            :...::|:.|.:.:.:....|
  Fly    73 IMNMIKLYGKPIRVNKASAHQ 93

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:240782 21/75 (28%)
RRM <70..210 CDD:223796 22/82 (27%)
SpxNP_511058.1 RRM1_SF3B4 15..88 CDD:240780 20/73 (27%)
RRM2_SF3B4 99..181 CDD:240781
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D491103at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.