DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11454 and Rbm11

Sequence 1:NP_608497.1 Gene:CG11454 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:XP_006248056.1 Gene:Rbm11 RGDID:1305195 Length:238 Species:Rattus norvegicus

Alignment Length:229 Identity:61/230 (27%)
Similarity:98/230 (43%) Gaps:70/230 (30%)


  Fly    65 EDEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDNNGRPRNFGFVTYQRLCAVPFALDL 129
            ::|..||:|.|||:.||.||||||:||||||:..|.:..|.:|:|::||||.::...:|.:|:.|
  Rat     5 QEEADRTVFVGNLEARVREEILYELFLQAGPLTKVTLCKDRDGKPKSFGFVCFKHPESVSYAIAL 69

  Fly   130 YQGLELFQKKVTIKQQGGKQL---PAYNQS----------RLRNQFMM--------------EAL 167
            ..|:.|:.:.:.::.:.|...   || |||          ..||..|:              .||
  Rat    70 LNGIRLYGRPINVQYRFGSSRSSEPA-NQSFESCAKINSHSFRNDEMVCRPSFPVPFFPITSAAL 133

  Fly   168 PQ----------------------------PSPLRHARHSLHNGKPYDRNPFGHNADQRRRSDSS 204
            ||                            |:|...: .||::....:..|..:....:..:|..
  Rat   134 PQEYFFFQKMQWYTHSPALQPPFYEMTAPLPNPASDS-CSLNHAPDLEAGPSSYEWTHQPPNDPD 197

  Fly   205 V---MERNRLKPQQHHQHMQGGSRRSDQRSNNKR 235
            :   ::|.|.:|...          ||..|.:||
  Rat   198 LYPRIKRKRQRPDSD----------SDSSSGDKR 221

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:240782 33/74 (45%)
RRM <70..210 CDD:223796 53/198 (27%)
Rbm11XP_006248056.1 RRM <1..139 CDD:223796 47/135 (35%)
RRM_RBM11 9..83 CDD:241037 33/74 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C273154809
eggNOG 1 0.900 E1_KOG4454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1298240at2759
OrthoFinder 1 1.000 FOG0002003
OrthoInspector 1 1.000 T1088239
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13798
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
76.900

Return to query results.
Submit another query.