DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11454 and Rbm11

Sequence 1:NP_608497.1 Gene:CG11454 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_938044.1 Gene:Rbm11 MGIID:2447622 Length:238 Species:Mus musculus

Alignment Length:225 Identity:63/226 (28%)
Similarity:99/226 (44%) Gaps:62/226 (27%)


  Fly    65 EDEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDNNGRPRNFGFVTYQRLCAVPFALDL 129
            ::|..||:|.|||:.||.||||||:||||||:..|.:..|.:|:|::||||.::...:|.:|:.|
Mouse     5 QEEADRTVFVGNLEARVREEILYELFLQAGPLTKVTLCKDRDGKPKSFGFVCFKHPESVSYAIAL 69

  Fly   130 YQGLELFQKKVTIKQQGGKQL---PAYNQS----------RLRNQFM--------------MEAL 167
            ..|:.|:.:.:.::.:.|...   || |||          ..||..|              ..||
Mouse    70 LNGIRLYGRPINVQYRFGSSRSSEPA-NQSFESCAKINSHSFRNDEMAGRPSFPVPFFPITSAAL 133

  Fly   168 PQ------------------------PSPLRHA---RHSLHNGKPYDRNPFGHNADQRRRSDSSV 205
            ||                        |:||.::   ..:|::....:..|..:....:..||..:
Mouse   134 PQEYFFFQKMPWYAHSPVLQPPFCEMPAPLPNSVPGSCALNHSPGPEAGPSSYEWTHQPPSDPDL 198

  Fly   206 MERNRLKPQQHHQHMQGGSRRSDQRSNNKR 235
            ..||:.|.|:....       ||..|.:||
Mouse   199 YPRNKRKRQRPDSD-------SDSSSEDKR 221

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:240782 33/74 (45%)
RRM <70..210 CDD:223796 55/194 (28%)
Rbm11NP_938044.1 RRM <5..139 CDD:223796 47/135 (35%)
RRM_RBM11 9..83 CDD:241037 33/74 (45%)
Bipartite nuclear localization signal. {ECO:0000305} 202..237 8/28 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C273155179
eggNOG 1 0.900 E1_KOG4454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1298240at2759
OrthoFinder 1 1.000 FOG0002003
OrthoInspector 1 1.000 T616779
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13798
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5568
TreeFam 1 0.960
87.930

Return to query results.
Submit another query.