DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and cpf-2

DIOPT Version :9

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_499734.1 Gene:cpf-2 / 176742 WormBaseID:WBGene00000774 Length:336 Species:Caenorhabditis elegans


Alignment Length:174 Identity:35/174 - (20%)
Similarity:71/174 - (40%) Gaps:28/174 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 DEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTD-NNGRPRNFGFVTYQRLCAVPFALDL 129
            |..||::|.||:...|:|:.:..:|.:||.:..:::..| ..|:|:.:||:.:..:.....|:..
 Worm    14 DRSQRSVFVGNISYDVSEDTIRSIFSKAGNVLSIKMVHDRETGKPKGYGFIEFPDIQTAEVAIRN 78

  Fly   130 YQGLELFQKKVTI-KQQGGKQLPAYNQSRLRNQFMMEALPQPSPLRHARHSLHNGKPYDRNPFGH 193
            ..|.||..:.:.: ...||..:..:..|.          ..|:|:             :.||:|.
 Worm    79 LNGYELSGRILRVDSAAGGMNMEEFGSSS----------NAPAPV-------------EENPYGP 120

  Fly   194 NADQRRRSDSSVMERNRLKPQQHHQHMQGGSRRSDQRSNNKRRL 237
            ..|..:..:........|.|::..:.|:   :..:...||...|
 Worm   121 ECDAGKAPERISQTVASLAPEKMFELMK---QLQESLKNNPSEL 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:240782 19/75 (25%)
RRM <70..210 CDD:223796 27/141 (19%)
cpf-2NP_499734.1 RRM_CSTF2_RNA15_like 20..94 CDD:240844 17/73 (23%)
CSTF2_hinge 115..194 CDD:373015 10/50 (20%)
CSTF_C 299..334 CDD:373006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.