DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and cpf-2

DIOPT Version :10

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_499734.1 Gene:cpf-2 / 176742 WormBaseID:WBGene00000774 Length:336 Species:Caenorhabditis elegans


Alignment Length:174 Identity:35/174 - (20%)
Similarity:71/174 - (40%) Gaps:28/174 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 DEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTD-NNGRPRNFGFVTYQRLCAVPFALDL 129
            |..||::|.||:...|:|:.:..:|.:||.:..:::..| ..|:|:.:||:.:..:.....|:..
 Worm    14 DRSQRSVFVGNISYDVSEDTIRSIFSKAGNVLSIKMVHDRETGKPKGYGFIEFPDIQTAEVAIRN 78

  Fly   130 YQGLELFQKKVTI-KQQGGKQLPAYNQSRLRNQFMMEALPQPSPLRHARHSLHNGKPYDRNPFGH 193
            ..|.||..:.:.: ...||..:..:..|.          ..|:|:             :.||:|.
 Worm    79 LNGYELSGRILRVDSAAGGMNMEEFGSSS----------NAPAPV-------------EENPYGP 120

  Fly   194 NADQRRRSDSSVMERNRLKPQQHHQHMQGGSRRSDQRSNNKRRL 237
            ..|..:..:........|.|::..:.|:   :..:...||...|
 Worm   121 ECDAGKAPERISQTVASLAPEKMFELMK---QLQESLKNNPSEL 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:409773 19/75 (25%)
cpf-2NP_499734.1 RRM_CSTF2_RNA15_like 18..94 CDD:409832 18/75 (24%)
CSTF2_hinge 115..194 CDD:433869 10/50 (20%)
CSTF_C 299..334 CDD:464130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.