DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11454 and rbm-7

Sequence 1:NP_608497.1 Gene:CG11454 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_499686.2 Gene:rbm-7 WormBaseID:WBGene00012558 Length:243 Species:Caenorhabditis elegans

Alignment Length:173 Identity:46/174 (26%)
Similarity:79/174 (45%) Gaps:34/174 (20%)


  Fly    68 EQRTLFCGNLDERVTEEILYEVFLQAGPIEGV--RIPTDNNGRPRNFGFVTYQRLCAVPFALDLY 130
            |:||::..|..|.|.||:|.|:|:||||:..|  |...|:|.:   |..|.::...:|.||::|.
 Worm    11 EERTIYVANFSEEVDEELLEELFIQAGPVVKVILRDVRDSNAK---FALVEFEDELSVLFAIELM 72

  Fly   131 QGLELFQKKVTIKQQGG---KQLPAYNQSRLRNQFMMEALPQPSPLRHARHSLHNGKPYDRNPFG 192
            .|:.||.:::.:|.:.|   ::|....:..:..:....|.|.....|.:.....|     ||..|
 Worm    73 NGVRLFNQELQVKPRNGTNQEELYKRKKGEIEERVRSVAAPDRDGRRDSYRDDRN-----RNRNG 132

  Fly   193 HNADQRRRSDSSVMERNRLKPQQHHQH-----------MQGGS 224
            :|.|..::.          :|.:||:.           :.|||
 Worm   133 NNRDSWQQQ----------QPPRHHRQYDPLPPPPPPPLMGGS 165

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:240782 27/76 (36%)
RRM <70..210 CDD:223796 39/145 (27%)
rbm-7NP_499686.2 RRM <1..>122 CDD:223796 34/114 (30%)
RRM_SF 12..85 CDD:302621 27/76 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C273132107
eggNOG 1 0.900 E1_KOG4454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I3989
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1298240at2759
OrthoFinder 1 1.000 FOG0002003
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_135149
Panther 1 1.100 LDO PTHR13798
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5568
TreeFam 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.