powered by:
                  
 
    
 
    
             
          
            Protein Alignment CG11454 and rbm-7
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_608497.1 | 
            Gene: | CG11454 / 33175 | 
            FlyBaseID: | FBgn0031224 | 
            Length: | 238 | 
            Species: | Drosophila melanogaster | 
          
          
            | Sequence 2: | NP_499686.2 | 
            Gene: | rbm-7 / 176710 | 
            WormBaseID: | WBGene00012558 | 
            Length: | 243 | 
            Species: | Caenorhabditis elegans | 
          
        
        
        
          
            | Alignment Length: | 173 | 
            Identity: | 46/173 - (26%) | 
          
          
            | Similarity: | 79/173 -  (45%) | 
            Gaps: | 34/173 - (19%) | 
          
        
      
- Green bases have known domain annotations that are detailed below.
      | 
 
  Fly    68 EQRTLFCGNLDERVTEEILYEVFLQAGPIEGV--RIPTDNNGRPRNFGFVTYQRLCAVPFALDLY 130 
            |:||::..|..|.|.||:|.|:|:||||:..|  |...|:|.:   |..|.::...:|.||::|. 
 Worm    11 EERTIYVANFSEEVDEELLEELFIQAGPVVKVILRDVRDSNAK---FALVEFEDELSVLFAIELM 72 
 
  Fly   131 QGLELFQKKVTIKQQGG---KQLPAYNQSRLRNQFMMEALPQPSPLRHARHSLHNGKPYDRNPFG 192 
            .|:.||.:::.:|.:.|   ::|....:..:..:....|.|.....|.:.....|     ||..| 
 Worm    73 NGVRLFNQELQVKPRNGTNQEELYKRKKGEIEERVRSVAAPDRDGRRDSYRDDRN-----RNRNG 132 
 
  Fly   193 HNADQRRRSDSSVMERNRLKPQQHHQH-----------MQGGS 224 
            :|.|..::.          :|.:||:.           :.||| 
 Worm   133 NNRDSWQQQ----------QPPRHHRQYDPLPPPPPPPLMGGS 165 
 
       | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | 
            Simple Score | 
            Weighted Score | 
            Original Tool Information | 
          
          
            | BLAST Result | 
            Score | 
            Score Type | 
            Cluster ID | 
          
          
          
            | Compara | 
            1 | 
            0.930 | 
            - | 
            - | 
             | 
            C160166376 | 
          
          
            | Domainoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | eggNOG | 
            1 | 
            0.900 | 
            - | 
            - | 
             | 
            E1_KOG4454 | 
          
          
            | Hieranoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Homologene | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Inparanoid | 
            1 | 
            1.050 | 
            59 | 
            1.000 | 
            Inparanoid score | 
            I4025 | 
          
          
            | Isobase | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OMA | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoDB | 
            1 | 
            1.010 | 
            - | 
            - | 
             | 
            D1298240at2759 | 
          
          
            | OrthoFinder | 
            1 | 
            1.000 | 
            - | 
            - | 
             | 
            FOG0003483 | 
          
          
            | OrthoInspector | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | orthoMCL | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Panther | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Phylome | 
            1 | 
            0.910 | 
            - | 
            - | 
             | 
             | 
          
          
            | RoundUp | 
            1 | 
            1.030 | 
            - | 
            avgDist | 
            Average_Evolutionary_Distance | 
            R5568 | 
          
          
            | SonicParanoid | 
            1 | 
            1.000 | 
            - | 
            - | 
             | 
            X2850 | 
          
          
            | SwiftOrtho | 
            1 | 
            1.000 | 
            - | 
            - | 
             | 
             | 
          
          
            | TreeFam | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
             | 
            9 | 8.830 | 
             | 
          
        
      
           
             Return to query results.
             Submit another query.