DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3164 and Abcg1

Sequence 1:NP_722605.1 Gene:CG3164 FlyBaseID:FBgn0025683 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_445954.1 Gene:Abcg1 RGDID:620294 Length:666 Species:Rattus norvegicus

Alignment Length:666 Identity:317/667 (48%)
Similarity:427/667 (64%) Gaps:73/667 (11%)


  Fly    39 LPKRPAVDLAFHNLTYRVKEG---NRSNAKTILKGVSGRLRSGELTAIMGPSGAGKSTLLNILSG 100
            ||:|.||::.|.:|:|.|.||   .:...||:|||:||:..||||.|||||||||||||:|||:|
  Rat    69 LPRRAAVNIEFKDLSYSVPEGPWWRKKGYKTLLKGISGKFNSGELVAIMGPSGAGKSTLMNILAG 133

  Fly   101 YKTSSIEGSVTMNGAERNLSAFRKLSAYIMQDNQLHGNLTVQEAMTVATNLKLSKKFSKPEKHSM 165
            |:.:.::|:|.:||..|:|..|||:|.|||||:.|..:|||||||.|:.:|||.::  ...:..|
  Rat   134 YRETGMKGAVLINGMPRDLRCFRKVSCYIMQDDMLLPHLTVQEAMMVSAHLKLQER--DEGRREM 196

  Fly   166 IDDILLTLSLSEHRYTMTRNLSGGQKKRLSIALELVSNPPIMFFDEPTSGLDSSTCFQCIHLLKM 230
            :.:||..|.|.....|.|.:|||||:|||:||||||:|||:||||||||||||::|||.:.|:|.
  Rat   197 VKEILTALGLLPCANTRTGSLSGGQRKRLAIALELVNNPPVMFFDEPTSGLDSASCFQVVSLMKG 261

  Fly   231 LAAGGRTVICTIHQPSARLFEMFDQLYTLADGQCVYQGSTKQLVPFLSTLNLECPSYHNPASYVI 295
            ||.|||:::||||||||:|||:|||||.|:.|||||:|....|||:|..|.|.||:|||||.:|:
  Rat   262 LAQGGRSIVCTIHQPSAKLFELFDQLYVLSQGQCVYRGKVSNLVPYLRDLGLNCPTYHNPADFVM 326

  Fly   296 EVSCGEHGDHTRKLVDAIDNGKRDVRSSADYAGLKARNDLVKVQNLKAILDKNDASSVSGRKYED 360
            ||:.||:||...:||.|:..|..|    :||     :.:|....::...|....|.       ||
  Rat   327 EVASGEYGDQNSRLVRAVREGMCD----SDY-----KRELGGDGDVNPFLWHRPAE-------ED 375

  Fly   361 NLTLNNGLLNGMVNDIVKEGNVSSALVTTNERGDAMIDVEKSVNCTTALLTEEITSPERYPTSQF 425
            :.::              ||..|.                 |.:|.|                  
  Rat   376 SASM--------------EGCHSF-----------------SASCLT------------------ 391

  Fly   426 HQFWVVLKRTLLFSYRDWTLMYLRLFAHLLVGFLIGALYYDIGNDGAKVLSNLGFLFFNMLFLMY 490
             ||.::.|||.|...||..|.:||:.:|:.:|.|||.||..|||:..|||||.|||||:|||||:
  Rat   392 -QFCILFKRTFLSIMRDSVLTHLRITSHIGIGLLIGLLYLGIGNEAKKVLSNSGFLFFSMLFLMF 455

  Fly   491 TSMTITILSFPLEMPVLLKENFNRWYSLKSYYLAISVADLPFQAIFCVIYVSIVYYFTSQPWELF 555
            .::..|:|:|||||.|.|:|:.|.|||||:||||.::||:|||.:|.|.|.||||:.||||.:..
  Rat   456 AALMPTVLTFPLEMSVFLREHLNYWYSLKAYYLAKTMADVPFQIMFPVAYCSIVYWMTSQPSDAV 520

  Fly   556 RFSMFLSACLLISFVAQSVGLVVGAA-MNVQNGVFLAPVMSVPFLLFSGFFVSFDAIPVYLRWIT 619
            ||.:|.:...:.|.||||:||::||| .::|...|:.||.::|.|||||||||||.||.||:|::
  Rat   521 RFVLFAALGTMTSLVAQSLGLLIGAASTSLQVATFVGPVTAIPVLLFSGFFVSFDTIPTYLQWMS 585

  Fly   620 YLSYIRYGFEGTALATYGYGREKLRC-FQTYCHFKSPITTLEELDMVNANFTLDIVALIVIFVVL 683
            |:||:||||||..|:.||..||.|.| ....|||:.....|.|||:.||...||.:.|.:.|:.|
  Rat   586 YISYVRYGFEGVILSIYGLDREDLHCDIAETCHFQKSEAILRELDVENAKLYLDFIVLGIFFISL 650

  Fly   684 RISAYLFLRWKLKTVR 699
            |:.||..||:|::..|
  Rat   651 RLIAYFVLRYKIRAER 666

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3164NP_722605.1 ABCG_EPDR 44..268 CDD:213180 132/227 (58%)
3a01204 60..699 CDD:273361 305/641 (48%)
ABC2_membrane 431..630 CDD:279410 112/200 (56%)
Abcg1NP_445954.1 3a01204 60..666 CDD:273361 316/665 (48%)
ABCG_EPDR 74..299 CDD:213180 132/227 (58%)
ABC2_membrane 396..598 CDD:279410 113/202 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1131
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1022017at2759
OrthoFinder 1 1.000 FOG0000096
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19241
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
54.970

Return to query results.
Submit another query.