DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14618 and TRM10

Sequence 1:NP_608464.1 Gene:CG14618 FlyBaseID:FBgn0031189 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_199579.1 Gene:TRM10 AraportID:AT5G47680 Length:344 Species:Arabidopsis thaliana

Alignment Length:339 Identity:111/340 (33%)
Similarity:164/340 (48%) Gaps:45/340 (13%)


  Fly    19 NNC---PGTTP-----GTPMSKN----QLKKQRKLAEFAELRKLRREREREKKKQKRREAKELGL 71
            |.|   |.:.|     ..|:|||    |||:||..|:.||.:...:|.:|::.::|.:|.:|. |
plant    10 NGCFDKPESEPAPVNVSPPLSKNAQKKQLKQQRYEAKKAEKKAQEKEHKRKEGERKLKEWEET-L 73

  Fly    72 PVRTG-------PSRKELKK--------------RQLADGGKSGLSVAIDLDYDDLMQERDIVKC 115
            ...|.       .|||.|:|              .:|....:.|..:.:|:|:..||.|.:|...
plant    74 ANATEEERLKLIESRKSLRKERMEKRSEEKEKKIERLNQAKEIGQKIVVDVDFAHLMSESEISSL 138

  Fly   116 VKQCLRIYTINRRSPQPGNLHFTGIRRNGHIHESFKKNEGWENWHVQYYFDRGHTDIF--EHSQL 178
            |:|.:..|.:|.||..|.:|..||::  |.:.....|..|:|.|.::.. .|.:.:..  :...|
plant   139 VQQIMYCYAVNGRSTSPCHLWLTGVQ--GKMSTELDKLPGFEKWFIEKE-SRCYIEAMADQKDNL 200

  Fly   179 VYLTCESDRVLDKLQPGCTYVIGGLVDHNHFKGLCHSRATSAGLTTARLPLSEHVDMKTRAVLST 243
            ||||.:|:.|||.|.|...|:||||||.|.|||:..::|...|:.||:||:.|::.|.:..||:.
plant   201 VYLTADSETVLDDLDPKHIYIIGGLVDRNRFKGITMTKAQEQGIKTAKLPIGEYMKMSSSQVLTV 265

  Fly   244 YHVFELLTKVAAGQDWTTAILETIPMRKGAKAKITDKKEPNHCLEQQDEKQKQEAES-DKPTL-- 305
            ..|.|:|.|....:||.||....||.||.......|..:..|..|:..||..:..|| ||..|  
plant   266 NQVLEILVKFLETRDWKTAFFTVIPQRKRTGLDPVDCSKLEHISEEHQEKDTEANESADKHDLLE 330

  Fly   306 ---TAVESEIESHS 316
               ..||..:||.|
plant   331 RKKVCVEVPLESSS 344

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14618NP_608464.1 tRNA_m1G_MT 105..271 CDD:280003 63/168 (38%)
TRM10NP_199579.1 tRNA_m1G_MT 129..293 CDD:294285 63/167 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I1688
OMA 1 1.010
OrthoDB 1 1.010 D1396299at2759
OrthoInspector 1 1.000 T192320
orthoMCL 1 0.900 OOG5_127454
Panther 1 1.100 LDO PTHR13563
Phylome 1 0.910 0.684 Consistency score
87.980

Return to query results.
Submit another query.