DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14618 and trmt10c

Sequence 1:NP_608464.1 Gene:CG14618 FlyBaseID:FBgn0031189 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001007333.2 Gene:trmt10c ZFINID:ZDB-GENE-041114-12 Length:403 Species:Danio rerio

Alignment Length:277 Identity:78/278 (28%)
Similarity:118/278 (42%) Gaps:30/278 (11%)


  Fly    31 SKNQLKKQRKLAEFAELRKLRREREREKKKQKRREAKELGLPVRTGPSRKE-----------LKK 84
            :|:..||..|.....|.:|...:|::|||:.:|...|   |....|...:|           |:.
Zfish   107 TKSSKKKYLKFLAIKEAQKNNDKRKQEKKRAEREAGK---LQNNNGEEEEEERAAGPENTFMLRL 168

  Fly    85 R----------QLADGGKSGLSVAIDLDYDDLMQERDIVKCVKQCLRIYTINRRSPQPGNLHFTG 139
            |          :.|...:....:..|:.||..|...::...|.|.|.....|||..:|.:|||..
Zfish   169 RNNSIESAHNWRTAQAMRFDQPLVFDMSYDQQMSRHELENTVSQLLESEGFNRRVQEPFHLHFCN 233

  Fly   140 IRRNGHIHESFKKNEGWENWH--VQYYFDRGHTDIFEHSQLVYLTCESDRVLDKLQPGCTYVIGG 202
            ::..|..|....:..|.|.|.  :..:.:|...::|.|..|||||.:|..||........|::|.
Zfish   234 LQPGGAYHRELLRRYGDETWRRLLITHTERSPLELFPHQDLVYLTADSRSVLRTFDHTKVYIVGA 298

  Fly   203 LVDHNHFKGLCHSRATSAGLTTARLPLSEHVDMKTRAV-LSTYHVFELLTKVAAGQDWTTAILET 266
            :||.:...|...:.|....|.||||||.|::|....|. |:...:..:||.|.....|..| ||.
Zfish   299 MVDRSIRVGASLAIAKRFRLATARLPLDEYLDWDCGAKNLTLDQMIRILTTVKQTGCWQKA-LEF 362

  Fly   267 IPMR--KGAKAKITDKK 281
            :|.|  ||...:..||:
Zfish   363 VPKRKHKGFHQQSGDKR 379

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14618NP_608464.1 tRNA_m1G_MT 105..271 CDD:280003 53/171 (31%)
trmt10cNP_001007333.2 tRNA_m1G_MT 199..367 CDD:294285 53/169 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2967
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1545
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.