DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14618 and rswl

Sequence 1:NP_608464.1 Gene:CG14618 FlyBaseID:FBgn0031189 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_611335.1 Gene:rswl FlyBaseID:FBgn0034351 Length:446 Species:Drosophila melanogaster

Alignment Length:278 Identity:66/279 (24%)
Similarity:121/279 (43%) Gaps:42/279 (15%)


  Fly    34 QLKK---QRKLAEFAELRKLRREREREKKKQKRREAKELGLPVRTGPSRKEL------------K 83
            ::||   |||.||        |.:|.|::..:.|:.:|....:..|.....|            :
  Fly   123 EMKKEADQRKKAE--------RAKEAERRVAEMRKEREENTHIIYGLGHTSLFLRIYDTTINHWQ 179

  Fly    84 KRQLADGGKSGLSVAIDLDYDDLMQERDIVKCVKQCLRIYTINRRSPQPGNLHFTGIRRNGHIHE 148
            ..:|....:....:.:|..||:.|..|:.....||.:..:..||.:.:|.:||:...:.:....:
  Fly   180 NNRLTRAMQFAPKMVLDCSYDEHMNNREATYAAKQLMMCFAENRMNDEPFDLHYCNTQMDSRCMQ 244

  Fly   149 SFKK------NEGWE-NWHVQYYFDRGHTDIFEHSQLVYLT--CESDRVLDKLQPGCTYVIGGLV 204
            |.::      |..:. |.|.:.:     |::|....|||||  |..|.|  ...|...|::|.:|
  Fly   245 SLQRYIPTMHNPEFPINLHSKCF-----TELFPKQNLVYLTPHCREDLV--TYNPDDIYIVGAMV 302

  Fly   205 DHNHFKGLCHSRATSAGLTTARLPLSEHVDMKTRA--VLSTYHVFELLTKVAAGQDWTTAILETI 267
            |..:.:.|..::|...||..|||||..::...:.:  .|:...:..::..:....||.|| |:.:
  Fly   303 DTMNNEPLSLAKAKRLGLRMARLPLDRYLQWGSGSGKSLTLNQMINIMLDLKKTGDWDTA-LKHV 366

  Fly   268 PMRKGAKAKITDKKEPNH 285
            |.||..:.:...::|.:|
  Fly   367 PRRKVVQNEFQPRREKDH 384

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14618NP_608464.1 tRNA_m1G_MT 105..271 CDD:280003 45/177 (25%)
rswlNP_611335.1 tRNA_m1G_MT 201..370 CDD:294285 45/177 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C19396522
eggNOG 1 0.900 E1_KOG2967
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13563
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1545
43.960

Return to query results.
Submit another query.