| Sequence 1: | NP_608464.1 | Gene: | CG14618 / 33134 | FlyBaseID: | FBgn0031189 | Length: | 319 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_611335.1 | Gene: | rswl / 37124 | FlyBaseID: | FBgn0034351 | Length: | 446 | Species: | Drosophila melanogaster |
| Alignment Length: | 278 | Identity: | 66/278 - (23%) |
|---|---|---|---|
| Similarity: | 121/278 - (43%) | Gaps: | 42/278 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 34 QLKK---QRKLAEFAELRKLRREREREKKKQKRREAKELGLPVRTGPSRKEL------------K 83
Fly 84 KRQLADGGKSGLSVAIDLDYDDLMQERDIVKCVKQCLRIYTINRRSPQPGNLHFTGIRRNGHIHE 148
Fly 149 SFKK------NEGWE-NWHVQYYFDRGHTDIFEHSQLVYLT--CESDRVLDKLQPGCTYVIGGLV 204
Fly 205 DHNHFKGLCHSRATSAGLTTARLPLSEHVDMKTRA--VLSTYHVFELLTKVAAGQDWTTAILETI 267
Fly 268 PMRKGAKAKITDKKEPNH 285 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG14618 | NP_608464.1 | tRNA_m1G_MT | 105..271 | CDD:280003 | 44/176 (25%) |
| rswl | NP_611335.1 | tRNA_m1G_MT | 201..370 | CDD:294285 | 44/176 (25%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45450020 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG2967 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR13563 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1545 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.870 | |||||