DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14618 and Trmt10b

Sequence 1:NP_608464.1 Gene:CG14618 FlyBaseID:FBgn0031189 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001013108.1 Gene:Trmt10b RGDID:1310735 Length:316 Species:Rattus norvegicus

Alignment Length:255 Identity:74/256 (29%)
Similarity:128/256 (50%) Gaps:19/256 (7%)


  Fly    31 SKNQLKKQRKLAEFAELRKLRREREREKKKQKRREAKELG---LPVRTGPSRKELKKRQLADGGK 92
            |||..:|||........:|.:|::|||::|.||  |::||   .|..:....|.|.|.:|.:...
  Rat    60 SKNVQRKQRHWERIVSSKKSKRKQERERRKIKR--AEDLGNGTCPQHSKRFLKALTKEKLLEAKH 122

  Fly    93 SGLSVAIDLDYDDLMQERDIVKCVKQCLRIYTINRRSPQPGNLHFTGIRRNGHIHES-FKKNEGW 156
            ||..:.:||.....|.::::.:...|..|:|..|:::.:|..::.||...:..::|. .:.|:|:
  Rat   123 SGPRLCVDLSMTQHMSKKELSRLAGQIRRLYGSNKKASRPFWIYLTGFSTDSPLYEECLRMNDGF 187

  Fly   157 ENWHVQYYFDRGHTD---IFEHSQLVYLTCESDRVLDKLQPGCTYVIGGLVDHNHFKGLCHSRAT 218
            .    .|..|....|   :|....|||||.:|:..|:.:.....|:||||||.:..|.:...:|.
  Rat   188 S----AYVLDVTEEDCFSLFPLETLVYLTPDSEHPLEDIDLSTVYIIGGLVDESIQKKVTFQKAQ 248

  Fly   219 SAGLTTARLPLSEHV----DMKT--RAVLSTYHVFELLTKVAAGQDWTTAILETIPMRKG 272
            ...:.|||||:.||:    :.|.  ..:|:...||::|:.....:||..|:.:.:...||
  Rat   249 EYSVKTARLPIQEHMIRCQNEKNFHSEILAINQVFDILSAYLETRDWPEALKKGVSPGKG 308

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14618NP_608464.1 tRNA_m1G_MT 105..271 CDD:280003 46/176 (26%)
Trmt10bNP_001013108.1 tRNA_m1G_MT 135..307 CDD:294285 46/176 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2967
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1396299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127454
Panther 1 1.100 O PTHR13563
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.