DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14618 and Trmt10b

DIOPT Version :9

Sequence 1:NP_608464.1 Gene:CG14618 / 33134 FlyBaseID:FBgn0031189 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001013108.1 Gene:Trmt10b / 298081 RGDID:1310735 Length:316 Species:Rattus norvegicus


Alignment Length:255 Identity:74/255 - (29%)
Similarity:128/255 - (50%) Gaps:19/255 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SKNQLKKQRKLAEFAELRKLRREREREKKKQKRREAKELG---LPVRTGPSRKELKKRQLADGGK 92
            |||..:|||........:|.:|::|||::|.||  |::||   .|..:....|.|.|.:|.:...
  Rat    60 SKNVQRKQRHWERIVSSKKSKRKQERERRKIKR--AEDLGNGTCPQHSKRFLKALTKEKLLEAKH 122

  Fly    93 SGLSVAIDLDYDDLMQERDIVKCVKQCLRIYTINRRSPQPGNLHFTGIRRNGHIHES-FKKNEGW 156
            ||..:.:||.....|.::::.:...|..|:|..|:::.:|..::.||...:..::|. .:.|:|:
  Rat   123 SGPRLCVDLSMTQHMSKKELSRLAGQIRRLYGSNKKASRPFWIYLTGFSTDSPLYEECLRMNDGF 187

  Fly   157 ENWHVQYYFDRGHTD---IFEHSQLVYLTCESDRVLDKLQPGCTYVIGGLVDHNHFKGLCHSRAT 218
            .    .|..|....|   :|....|||||.:|:..|:.:.....|:||||||.:..|.:...:|.
  Rat   188 S----AYVLDVTEEDCFSLFPLETLVYLTPDSEHPLEDIDLSTVYIIGGLVDESIQKKVTFQKAQ 248

  Fly   219 SAGLTTARLPLSEHV----DMKT--RAVLSTYHVFELLTKVAAGQDWTTAILETIPMRKG 272
            ...:.|||||:.||:    :.|.  ..:|:...||::|:.....:||..|:.:.:...||
  Rat   249 EYSVKTARLPIQEHMIRCQNEKNFHSEILAINQVFDILSAYLETRDWPEALKKGVSPGKG 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14618NP_608464.1 tRNA_m1G_MT 105..271 CDD:280003 46/175 (26%)
Trmt10bNP_001013108.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..98 16/39 (41%)
tRNA_m1G_MT 135..307 CDD:294285 46/175 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2967
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1396299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.