DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14618 and Trmt10a

Sequence 1:NP_608464.1 Gene:CG14618 FlyBaseID:FBgn0031189 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_006233430.1 Gene:Trmt10a RGDID:1594565 Length:340 Species:Rattus norvegicus

Alignment Length:344 Identity:119/345 (34%)
Similarity:171/345 (50%) Gaps:55/345 (16%)


  Fly     1 MDTTEKALKEVTPAMLSLNNCPGTTPGTPMSKNQLKKQRKLAEF-----AELRKLRRER----ER 56
            |:||..: .||.||.:...|..| .||...|:.:.:|||..||.     .:|:||.::|    :|
  Rat     1 METTNMS-SEVLPASIEPPNVEG-KPGASDSEEERQKQRVDAEAQPISKRQLKKLMKQRLWEEQR 63

  Fly    57 EKKKQKRREAKELGLPVRTGPSRKELKKR-QL---ADG----------GKSGLSVAIDLDYDDLM 107
            |::|:||:|.::          ||:|::| ||   :||          ..|.|.:.||..:||||
  Rat    64 EQRKEKRKEKRK----------RKKLERRCQLESNSDGNDRKRIRRHVAPSNLRLIIDCSFDDLM 118

  Fly   108 QERDIVKCVKQCLRIYTINRRSPQPGNLHFTGIRRNGHIHESFKKN-EGWENWHVQYYFDRGHTD 171
            ..:||.|..||..|.|..|||:..|...:.|.  ..|.:.::..:| :||.||...:.....:::
  Rat   119 VLKDIKKLHKQIQRCYAENRRASHPVQFYLTS--HGGQLKKNMDENDQGWVNWKDIHIKSEHYSE 181

  Fly   172 IFEHSQLVYLTCESDRVLDKLQPGCTYVIGGLVDHNHFKGLCHSRATSAGLTTARLPLSEHVDMK 236
            :.:...|||||.:|..||..|.....|||||||||||.|||...:|:|.|:..|:|||:|.|.|.
  Rat   182 LIKKEDLVYLTSDSPNVLKDLDESKAYVIGGLVDHNHHKGLTFKQASSYGIKHAQLPLAEFVKMN 246

  Fly   237 TRAVLSTYHVFELLTKVAAGQDWTTAILETIPMRKGAKAKITDKKEPNH--CLEQQDEKQKQEAE 299
            :|.||:..||||::.:.....||..|....:|.||||        .|.|  |.....:.|.....
  Rat   247 SRKVLAVNHVFEIILEFLETGDWQEAFFTILPPRKGA--------VPAHKACESSPQDHQALPGG 303

  Fly   300 SDKPTLTAVESEIESHSLD 318
            .|    :|:|.|   |..|
  Rat   304 WD----SAIEGE---HGRD 315

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14618NP_608464.1 tRNA_m1G_MT 105..271 CDD:280003 66/167 (40%)
Trmt10aXP_006233430.1 tRNA_m1G_MT 116..281 CDD:294285 66/167 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C19191175
eggNOG 1 0.900 E1_KOG2967
Hieranoid 1 1.000
Homologene 1 1.000 H6886
Inparanoid 1 1.050 161 1.000 Inparanoid score I4076
OMA 1 1.010
OrthoDB 1 1.010 D1396299at2759
OrthoFinder 1 1.000 FOG0003812
OrthoInspector 1 1.000 T1088351
orthoMCL 1 0.900 OOG5_127454
Panther 1 1.100 LDO PTHR13563
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.