DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14618 and F46F11.10

Sequence 1:NP_608464.1 Gene:CG14618 FlyBaseID:FBgn0031189 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_491647.3 Gene:F46F11.10 WormBaseID:WBGene00018513 Length:390 Species:Caenorhabditis elegans

Alignment Length:310 Identity:73/311 (23%)
Similarity:121/311 (39%) Gaps:69/311 (22%)


  Fly    32 KNQLKKQRKLAEFAE----LRKLRREREREKKKQKR---REAKE-----------LGLPVRTGPS 78
            |..|:.:.:.:.|.|    .||.:.|.|..:||.::   |:..|           |..|......
 Worm    85 KTFLELKSRKSRFDEAMFLFRKEKLEEEDARKKLEKVNFRKISEQNVGSRVPSYMLHFPNSVSEE 149

  Fly    79 RKELKKRQLADGGKSGLSVAIDLDYDDLMQERDIVKCVKQCLRIYTINRRSPQPGNLHFTGIR-- 141
            ..::|:...|...::...:|:|..:...:..|.......|...:.|.|||:|.|..|||....  
 Worm   150 YYQMKRLYEAYLLENRPILAVDCQFLSRLSPRGRGLTALQLQYLITENRRNPDPFRLHFVNYDSK 214

  Fly   142 ---------------RNGHIHESFKKNEGWENWHVQYYFDRGHTDIFEHSQ-LVYLTCESDRVLD 190
                           |..|:........|.|.:.             .||: ::||:.::...|:
 Worm   215 NSSIQDLEKSKLQSIRKSHVFNPIVTENGLETYE-------------NHSKNVIYLSPDATEELE 266

  Fly   191 KLQPGCTYVIGGLVDHNHFKGL-CHS---RATSAGLTTARLPLSEHVDMKTRA-VLSTYHVFELL 250
            .:.....|||||:||.....|: .|:   .:.|||:...:||:..:||.|:.: .|:...|.|:|
 Worm   267 SVDDDKIYVIGGIVDRVPEPGIPKHASLEASQSAGVFARKLPIDRYVDFKSGSKFLTLLAVAEIL 331

  Fly   251 TKVAAGQDWTTAILETIPMR--KGAKAKITDKKEPN--------HCLEQQ 290
            .:|....||..|:...||:|  :||     |:|.|.        |...|:
 Worm   332 RQVNIHGDWKKAMKVAIPVRNTRGA-----DEKNPKARAAQLRIHAFNQE 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14618NP_608464.1 tRNA_m1G_MT 105..271 CDD:280003 48/191 (25%)
F46F11.10NP_491647.3 tRNA_m1G_MT 176..352 CDD:280003 48/189 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2967
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13563
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1545
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.