DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14618 and trm10

Sequence 1:NP_608464.1 Gene:CG14618 FlyBaseID:FBgn0031189 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_593764.1 Gene:trm10 PomBaseID:SPAC6B12.09 Length:304 Species:Schizosaccharomyces pombe

Alignment Length:298 Identity:88/299 (29%)
Similarity:147/299 (49%) Gaps:31/299 (10%)


  Fly    25 TPGTPMSKNQLKKQRKLAEFAELRKLRRERE----REKKKQKRREAKELGLPVRTGPSRKELKKR 85
            |....:|||:.::|..|::.| |::|:|::|    |||:.:.|||.|.|         |||.:||
pombe    16 TSEADVSKNETQEQPVLSKSA-LKRLKRQQEWDAGREKRAEMRREKKRL---------RKEERKR 70

  Fly    86 QLADG------------GK---SGLSVAIDLDYDDLMQERDIVKCVKQCLRIYTINRRSPQPGNL 135
            ::..|            ||   |.:.:.:|..:||||.:::|....:|..|.::.||.:..|..|
pombe    71 KIEAGEVVKSQKKRIRLGKVVPSSIRIVLDCAFDDLMNDKEINSLCQQVTRCHSANRTALHPVEL 135

  Fly   136 HFTGIRRNGHIHESFKKNEGWENWHVQYYFDRGHTDIFE--HSQLVYLTCESDRVLDKLQPGCTY 198
            ..|.........:.|.......||.......:.:.:.||  ..:||||:.:||..:.:|.....|
pombe   136 FATNFGGRLKTRQDFVLKGQQNNWKRYNPTTKSYLEEFESQKEKLVYLSADSDNTITELDEDKIY 200

  Fly   199 VIGGLVDHNHFKGLCHSRATSAGLTTARLPLSEHVDMKTRAVLSTYHVFELLTKVAAGQDWTTAI 263
            :||.:||.|.:|.||.::|:..|:.||:||:.|::.:..|.:|:...|||:|:.....:||..|.
pombe   201 IIGAIVDKNRYKNLCQNKASEQGIKTAKLPIDEYIKITDRKILTVNQVFEILSLWLEYRDWEKAF 265

  Fly   264 LETIPMRKGAKAKITDKKEPNHCLEQQDEKQKQEAESD 301
            :|.||.|||...|..:..:.:.....|..:...|.|.:
pombe   266 MEVIPKRKGILLKSDESFDVSEDTRSQSNQSDSELEKE 303

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14618NP_608464.1 tRNA_m1G_MT 105..271 CDD:280003 52/168 (31%)
trm10NP_593764.1 tRNA_m1G_MT 105..273 CDD:280003 52/168 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6886
Inparanoid 1 1.050 135 1.000 Inparanoid score I1381
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003812
OrthoInspector 1 1.000 T1125579
orthoMCL 1 0.900 OOG5_127454
Panther 1 1.100 LDO PTHR13563
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1545
TreeFam 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.