| Sequence 1: | NP_608464.1 | Gene: | CG14618 / 33134 | FlyBaseID: | FBgn0031189 | Length: | 319 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011516037.1 | Gene: | TRMT10B / 158234 | HGNCID: | 26454 | Length: | 329 | Species: | Homo sapiens |
| Alignment Length: | 252 | Identity: | 66/252 - (26%) |
|---|---|---|---|
| Similarity: | 122/252 - (48%) | Gaps: | 15/252 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 31 SKNQLKKQRKLAEFAELRKLRREREREKKKQKRREAKELGLPVRTGPSRKELKKRQLADGGKSGL 95
Fly 96 SVAIDLDYDDLMQERDIVKCVKQCLRIYTINRRSPQPGNLHFTGIRRNGHIHES-FKKNEGWENW 159
Fly 160 HVQYYFDRGHTD---IFEHSQLVYLTCESDRVLDKLQPGCTYVIGGLVDHNHFKGLCHSRATSAG 221
Fly 222 LTTARLPLSEHVDMKTRA------VLSTYHVFELLTKVAAGQDWTTAILETIPMRKG 272 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG14618 | NP_608464.1 | tRNA_m1G_MT | 105..271 | CDD:280003 | 42/175 (24%) |
| TRMT10B | XP_011516037.1 | tRNA_m1G_MT | 149..320 | CDD:294285 | 42/174 (24%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG2967 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1396299at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.820 | |||||