DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14618 and Trmt10a

Sequence 1:NP_608464.1 Gene:CG14618 FlyBaseID:FBgn0031189 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001335125.1 Gene:Trmt10a MGIID:1920421 Length:330 Species:Mus musculus

Alignment Length:315 Identity:110/316 (35%)
Similarity:163/316 (52%) Gaps:28/316 (9%)


  Fly    10 EVTPAMLSLNNCP---GTTPG-------------TPMSKNQLKKQRKLAEFAELRKLRREREREK 58
            |:.||.:...|..   ||:.|             .|:||.||||..|..::.|.|:.|:|:.:||
Mouse     6 EMLPASIESTNVEEKLGTSDGEEERQEPRVDAGAEPISKRQLKKLMKQKQWEEQREQRKEKRKEK 70

  Fly    59 KKQKRREAKELGLPVRTGPSRKELKKRQLADGGKSGLSVAIDLDYDDLMQERDIVKCVKQCLRIY 123
            :|:|:.|.::|. ....|..||.:::    |..:|.|.:.||..:||||..:||.|..||..|.|
Mouse    71 RKRKKLERRQLE-SNSDGNDRKRVRR----DVARSSLRLVIDCSFDDLMVLKDIKKLHKQIQRCY 130

  Fly   124 TINRRSPQPGNLHFTGIRRNGHIHESFKKN-EGWENWHVQYYFDRGHTDIFEHSQLVYLTCESDR 187
            ..|||:..|...:.|.  ..|.:.::..:| :||.||...:.....::::.:...|||||.:|..
Mouse   131 AENRRASHPVQFYLTS--HGGQLKKNMDENDQGWVNWKDIHIKSEHYSELIKKEDLVYLTSDSPN 193

  Fly   188 VLDKLQPGCTYVIGGLVDHNHFKGLCHSRATSAGLTTARLPLSEHVDMKTRAVLSTYHVFELLTK 252
            ||..|.....|||||||||||.|||...:|||.|:..|:|||::.|.|.:|.||:..||||::.:
Mouse   194 VLKDLDESKAYVIGGLVDHNHHKGLTFKQATSYGIEHAQLPLADFVKMNSRKVLAVNHVFEIILE 258

  Fly   253 VAAGQDWTTAILETIPMRKGA----KAKITDKKEPNHCLEQQDEKQKQEAESDKP 303
            ....:||..|....:|.||||    ||..:..::.....|..|...:.|:..|.|
Mouse   259 FLETRDWQEAFFTILPQRKGAVPAHKACESSPQDHQSLPEGWDSASEGESCRDNP 313

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14618NP_608464.1 tRNA_m1G_MT 105..271 CDD:280003 66/167 (40%)
Trmt10aNP_001335125.1 tRNA_m1G_MT 112..277 CDD:294285 66/167 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C19191167
eggNOG 1 0.900 E1_KOG2967
Hieranoid 1 1.000
Homologene 1 1.000 H6886
Inparanoid 1 1.050 170 1.000 Inparanoid score I4105
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003812
OrthoInspector 1 1.000 T1084800
orthoMCL 1 0.900 OOG5_127454
Panther 1 1.100 LDO PTHR13563
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1545
TreeFam 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.