DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14621 and frc

Sequence 1:NP_001285522.1 Gene:CG14621 FlyBaseID:FBgn0031183 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001137962.1 Gene:frc FlyBaseID:FBgn0042641 Length:373 Species:Drosophila melanogaster

Alignment Length:364 Identity:86/365 (24%)
Similarity:147/365 (40%) Gaps:85/365 (23%)


  Fly     4 KRTGSRHIAVVLLMCLFWYVISSSNNVIGKMVLNEFPFP--MTVTLVQLCSITLYSGPFFNLWRI 66
            |:.||         .||:.:.|....|:.|.||..:.||  :.::|.||.:..:..|....| ::
  Fly    62 KKIGS---------ALFYGLSSFMITVVNKTVLTSYHFPSFLFLSLGQLTASIVVLGMGKRL-KL 116

  Fly    67 RKYQDIPRPYYYRLIVPLALGKLLASVTSHISLWKVPVSYAHTVKATMPLF----------TVVL 121
            ..:..:.|..:.: |.||.|          |.|..:......|...::|:|          |::|
  Fly   117 VNFPPLQRNTFAK-IFPLPL----------IFLGNMMFGLGGTKTLSLPMFAALRRFSILMTMLL 170

  Fly   122 TRVFFGEKQPTLVYLSLLPIITGVGIATVTEISFDMMGLISALISTMGFSMQNIFSKKVLKDTNI 186
            .....|.:....|.:|:..:|.|..:|...::||:|.|.|..:|:....:...::.||.|..:.|
  Fly   171 ELKILGLRPSNAVQVSVYAMIGGALLAASDDLSFNMRGYIYVMITNALTASNGVYVKKKLDTSEI 235

  Fly   187 HHLRLLHLLGKLSLFIFLPLWLYMDSFAVFRHTAIKNLDYRVIALLFADG-----VLNWLQNIIA 246
            ....|::.   .|||:|||        |:..:....|||.   ||.|...     |:.:|.:.:.
  Fly   236 GKYGLMYY---NSLFMFLP--------ALALNYVTGNLDQ---ALNFEQWNDSVFVVQFLLSCVM 286

  Fly   247 FSVLSLVT--------PLTYAVASASKRIFVIAVSLLILGNPV-TWVNCVGMTLAIVGVLCYNRA 302
            ..:||..|        .||..:....|.|.|..:.:.|.|:.| :|:||:|:.::::..|.|   
  Fly   287 GFILSYSTILCTQFNSALTTTIVGCLKNICVTYLGMFIGGDYVFSWLNCIGINISVLASLLY--- 348

  Fly   303 KQLTRGREQPTLPLSQTSYV----KYSPLEQQADPYYRG 337
                             :||    |.:|.:|...|..||
  Fly   349 -----------------TYVTFRRKRAPDKQDHLPSTRG 370

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14621NP_001285522.1 TPT 13..300 CDD:281186 75/313 (24%)
frcNP_001137962.1 TPT 67..348 CDD:281186 74/307 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C118215740
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11132
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.