DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6t1 and Cyp6v1

Sequence 1:NP_608457.1 Gene:Cyp6t1 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001285499.1 Gene:Cyp6v1 FlyBaseID:FBgn0031126 Length:520 Species:Drosophila melanogaster

Alignment Length:519 Identity:197/520 (38%)
Similarity:303/520 (58%) Gaps:22/520 (4%)


  Fly    18 VLLPVVLRGGCLLVVTIVWLWQILHFWHWRRLGVPFVPAAPFVGNVWNLLRGACCFGDQFRELYE 82
            :||.:|      .::|.|::|....:.:|:|..|.||.....:||:..:||....|..|.|..|.
  Fly     7 ILLAIV------TILTGVFIWSRRTYVYWQRRRVKFVQPTHLLGNLSRVLRLEESFALQLRRFYF 65

  Fly    83 SKEAAGRAFVGIDVLHNHALLLRDPALIKRIMVEDFAQFSSRFETTDPTCDTMGSQNLFFSKYET 147
            .:.......|||.:.|..|||:||..|::.::||||..||:||...|...|.||:.:||.:|...
  Fly    66 DERFRNEPVVGIYLFHQPALLIRDLQLVRTVLVEDFVSFSNRFAKCDGRSDKMGALSLFLAKQPE 130

  Fly   148 WRETHKIFAPFFAAGKVRNMYGLLENIGQKLE---EHMEQKLSGRDSME---LEVKQLCALFTTD 206
            |||.....||.||..|::.|:.|:|.||..||   :.:.:.|...|:..   :.:|.:|.|:.||
  Fly   131 WREIRTRLAPAFAGAKLKQMFSLMEEIGCDLEWYLKRLTRDLRRGDAERGAIVSIKDVCDLYNTD 195

  Fly   207 IIASLAFGIEAHSLQNPEAEFRRMCIEVNDPRPKRLLHLFTMFFFPRLSHRVGTHLYSEEYERFM 271
            :|||:|||:.::||:|.::|....|.::..|..:|::.||.:|:.|:|...:...|::|.:..|:
  Fly   196 MIASIAFGLRSYSLRNTQSEIGSHCQDLFRPNVRRIIDLFVIFYLPKLVPLLRPKLFTEPHAEFL 260

  Fly   272 RKSMDYVLSQRAESGENRHDLIDIFLQLKR----TEPAESIIHRPDFFAAQAAFLLLAGFDTSSS 332
            |:.:..|:.:|...|:.|:|||::.|.||:    .:......|..||.|||||...:||.:|.|:
  Fly   261 RRVIQLVIEERERGGDLRNDLIEMLLTLKKEADLQQDKSHFTHHRDFLAAQAASFEVAGIETCSA 325

  Fly   333 TITFALYELAKNTTIQDRLRTELRAALQSSQDRQLSCDTVTGLVYLRQVVDEVLRLYPPTAFLDR 397
            :::||||||||...:|.|||.|:|.|..|:.:.:|:.:.|..:.:|..||:|.||.||....|:|
  Fly   326 SMSFALYELAKQPLMQSRLRREIREAFASNPNGRLTYEAVARMEFLDMVVEETLRKYPIVPLLER 390

  Fly   398 CC---NSRTGYDLSPWNGGSPFKLRAGTPVYISVLGIHRDAQYWPNPEVFDPERFSAEQRQQHHP 459
            .|   |.:..|.|.|   .:....|.|.||:||.|.||.|.:|||:|:.||||||||..:....|
  Fly   391 ECTPINKKRFYSLRP---HAECYTRRGMPVFISNLAIHHDPKYWPDPDRFDPERFSAANKALQAP 452

  Fly   460 MTYLPFGAGPRGCIGTLLGQLEIKVGLLHILNHFRVEVCERTLPEMRFDPKAFVLTAHNGTYLR 523
            |:|:|||||||.|||..:|.|:||:||::.|:..|||:|:||:..::||.|..:|.:....||:
  Fly   453 MSYMPFGAGPRNCIGMQIGLLQIKLGLVYFLHQHRVEICDRTVERIQFDAKFALLASEQRIYLK 516

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 176/437 (40%)
Cyp6v1NP_001285499.1 p450 59..517 CDD:299894 181/462 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139744017
eggNOG 1 0.900 E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1576
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24292
RoundUp 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.