DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-beta and klg

Sequence 1:NP_001138225.1 Gene:DIP-beta FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster

Alignment Length:422 Identity:108/423 (26%)
Similarity:171/423 (40%) Gaps:86/423 (20%)


  Fly    79 GNCIDLTVSNK----------------ISSVGAFEPDFVIPLENVTIAQGRDATFTCVVNNLGGH 127
            |..::..:||:                .|::.|..|.|:..........|......|.|.|||..
  Fly    66 GFAVEAAISNRGSNSRSMSNVQQSAVAASTLTATLPRFLSRGHTYRAVVGDTLVLPCQVENLGNF 130

  Fly   128 RVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQ 192
                       .:.|.:  ...:|.....::|.::|:.: .:.||   |.|..::.:|||.|:||
  Fly   131 -----------VLLWRR--GTNVLTASNIMVTRDERVRL-IDGYN---LEISDLEPQDAGDYVCQ 178

  Fly   193 VNTDPMKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIAR 257
            ::....:.|..|:|:::||.:....|||.:...:||...|.|:..|:|.|.|.|.::.|.     
  Fly   179 ISDKINRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLECKGSGNPVPSIYWTKKSGA----- 238

  Fly   258 NGSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGA 322
                .|:.|:..:|.:|||.|:.|.:.|.|.|.|.|||...|:..|:|.|.:.|.:||....:.:
  Fly   239 ----NKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLDVLYPPDIQVEKSWIHS 299

  Fly   323 PVLTDVTLICNVEASPKAINYWQRENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGY 387
            ....:..|:|.|.|.|.|...|. :|...|.:.||..:..:.|     ..:|.|:.:|..|||.|
  Fly   300 GEGFEAKLVCIVFADPVATVSWY-QNSFPIQSTDRRIMATRAN-----RHMLTIRHIQQEDFGNY 358

  Fly   388 KCISKNSIGDTEGTIRLYEMERPGK-------------------KILRDDDLNE-------VSKN 426
            .|::.||:|.:...:.|  ..|||.                   ||.....|.|       |..|
  Fly   359 SCVADNSLGRSRKYMEL--SGRPGAAEFYSPKWGRSPDSYNLTWKIDSYPPLEEVRLLYRRVQMN 421

  Fly   427 EVVQKDTRSEDGSRNLNGRLYKDRAPDQHPAS 458
            |..|:..|..|..          ..|:..|||
  Fly   422 ETYQQPGRWHDFI----------LTPEHRPAS 443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 25/111 (23%)
ig 102..195 CDD:278476 20/93 (22%)
IG_like 219..307 CDD:214653 30/88 (34%)
Ig 221..307 CDD:299845 28/86 (33%)
Ig 311..404 CDD:299845 26/93 (28%)
IG_like 327..405 CDD:214653 24/78 (31%)
klgNP_524454.2 DUF1370 63..>124 CDD:284518 9/58 (16%)
IG_like 109..195 CDD:214653 23/103 (22%)
Ig 118..191 CDD:143165 21/90 (23%)
IG_like 205..274 CDD:214653 27/78 (35%)
IGc2 213..273 CDD:197706 25/69 (36%)
IGc2 301..367 CDD:197706 22/72 (31%)
FN3 392..486 CDD:238020 14/63 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80496065
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000159
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.