DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tty and TTYH2

Sequence 1:NP_542443.4 Gene:tty FlyBaseID:FBgn0015558 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_116035.5 Gene:TTYH2 HGNCID:13877 Length:534 Species:Homo sapiens

Alignment Length:548 Identity:160/549 (29%)
Similarity:259/549 (47%) Gaps:65/549 (12%)


  Fly    11 YKVPVIAKLLHALPHYNITFHKINSTFRPNDEIYLESLGILGSVPAALLIVSLLGLLFYLMTRC- 74
            |..|.....||::||..:....:||||.|.||.|.|||..||.|.|..|.::|:.|:.||:..| 
Human     8 YIAPWWVVWLHSVPHVGLRLQPVNSTFSPGDESYQESLLFLGLVAAVCLGLNLIFLVAYLVCACH 72

  Fly    75 CDR----KPRPAHS--ITSLKVALSIVTVMCCAAIGLGLYGNDDLHNGLLEVLTAGRKVDNLVTT 133
            |.|    :.:..||  ||...|...::   ||||:|:|.|||.:.::|..:::.:   :|:...|
Human    73 CRRDDAVQTKQHHSCCITWTAVVAGLI---CCAAVGVGFYGNSETNDGAYQLMYS---LDDANHT 131

  Fly   134 IRNQTHILENTLTNRIR----PQLVELADIFDQPVSNQTALSKLFVSLNIVQ---GNVTLATNAA 191
            ......::..| |.:::    ..|..|::||       .|......:|..:|   |:|.:..:..
Human   132 FSGIDALVSGT-TQKMKVDLEQHLARLSEIF-------AARGDYLQTLKFIQQMAGSVVVQLSGL 188

  Fly   192 SDIRRPLMGISMTHFLTRGDQWELIRWPGTVATLALLLVLCAVLLVGVARHSRCALILFSVCGLL 256
            ...|...|  .:|....:....|..||...:....|.||:|.:..:|:|:.|:|.|.....||.|
Human   189 PVWREVTM--ELTKLSDQTGYVEYYRWLSYLLLFILDLVICLIACLGLAKRSKCLLASMLCCGAL 251

  Fly   257 AVTGSWLMSGLYLSSSVAVGDLCISPADFLVSTAPRDLPTNVLLHYTQCEPGHTNPFTQRLRESQ 321
            ::..||.......|::||..|.|::|..|:::.....:.|.|..:|..|....::||.|.|...|
Human   252 SLLLSWASLAADGSAAVATSDFCVAPDTFILNVTEGQISTEVTRYYLYCSQSGSSPFQQTLTTFQ 316

  Fly   322 NSLNNARSAMATVMKISLVLFKSSGLQPKLGAVNADLNSSERLLTQLTALVDCKAVHHNFLAAAR 386
            .:|...:..:|.:::.::.||.::  :..|.|:...|||||..|.||||:|||:.:|.::|.|..
Human   317 RALTTMQIQVAGLLQFAVPLFSTA--EEDLLAIQLLLNSSESSLHQLTAMVDCRGLHKDYLDALA 379

  Fly   387 GLCEGGLLGLVLMLIASFIAAILLTIMVWVDSHTWIYIRKRN-DYAQVDEPSYISHPAPQNHQQM 450
            |:|..||.||:.:.:.||:||:..:.|:......|.:...|| ||..:|:..      |.|.|..
Human   380 GICYDGLQGLLYLGLFSFLAALAFSTMICAGPRAWKHFTTRNRDYDDIDDDD------PFNPQAW 438

  Fly   451 MNAARTLPRNHNGHF-SPPVISGSHT-LQHPSKRQQHEMMAHAHIQQNM-RAMGTHTLGRLPSHN 512
            ..||.:.||.....| |.....||.| ||.|:     :.:::|.:.:.| :||   ..||.|.:.
Human   439 RMAAHSPPRGQLHSFCSYSSGLGSQTSLQPPA-----QTISNAPVSEYMNQAM---LFGRNPRYE 495

  Fly   513 HSPTHMTGPNNAAAVAAAANAAANMPPT 540
            :.|  :.|             .|:.|||
Human   496 NVP--LIG-------------RASPPPT 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ttyNP_542443.4 Tweety_N 10..429 CDD:143653 129/433 (30%)
TTYH2NP_116035.5 Tweety_N 7..422 CDD:143653 129/432 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C45054915
eggNOG 1 0.900 E1_KOG4433
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 196 1.000 Inparanoid score I3756
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D318605at33208
OrthoFinder 1 1.000 FOG0000756
OrthoInspector 1 1.000 T130239
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12424
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R7666
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.