DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tty and TTYH3

Sequence 1:NP_542443.4 Gene:tty FlyBaseID:FBgn0015558 Length:970 Species:Drosophila melanogaster
Sequence 2:XP_011513837.1 Gene:TTYH3 HGNCID:22222 Length:526 Species:Homo sapiens

Alignment Length:558 Identity:156/559 (28%)
Similarity:249/559 (45%) Gaps:66/559 (12%)


  Fly    11 YKVPVIAKLLHALPHYNITFHKINSTFRPNDEIYLESLGILGSVPAALLIVSLLGLLFYLMTRCC 75
            |..|....|||.|||:::::...:|.|||.|..|.::|.:||:...|.|.:.||.||||....||
Human     6 YAAPWWVSLLHRLPHFDLSWEATSSQFRPEDTDYQQALLLLGAAALACLALDLLFLLFYSFWLCC 70

  Fly    76 DRKPRPAH---SITSLKVALSIVTVMCCAAIGLGLYGN----DDLHNGLLEVLTAGRKV----DN 129
            .|:....|   ........:.|.|::|.|.|.:|.|||    |.:|.....:..|.|.|    |.
Human    71 RRRKSEEHLDADCCCTAWCVIIATLVCSAGIAVGFYGNGETSDGIHRATYSLRHANRTVAGVQDR 135

  Fly   130 LVTTIRNQTHILE---NTLTNRI--RPQLVELADIFDQPVSNQTALSKLFVSLNIVQGNVTLATN 189
            :..|.....|..|   .||..::  ||          :|:.....|..|..:|......:....|
Human   136 VWDTAVGLNHTAEPSLQTLERQLAGRP----------EPLRAVQRLQGLLETLLGYTAAIPFWRN 190

  Fly   190 AASDIRRPLMGISMTHFLTRGDQWELIRWPGTVATLALLLVLCAVLLVGVARHSRCALILFSVCG 254
            .|         :|:.....:.|.::..||.|.:..|.|.:::|.::|||:.|.|:..|:...:.|
Human   191 TA---------VSLEVLAEQVDLYDWYRWLGYLGLLLLDVIICLLVLVGLIRSSKGILVGVCLLG 246

  Fly   255 LLAVTGSWLMSGLYLSSSVAVGDLCISPADFLVSTAPRD---LPTNVLLHYTQCEPGHTNPFTQR 316
            :||:..||...||.|:.||...|.|:.| |..|:....:   |..::|.:|..|.|...|||.|:
Human   247 VLALVISWGALGLELAVSVGSSDFCVDP-DAYVTKMVEEYSVLSGDILQYYLACSPRAANPFQQK 310

  Fly   317 LRESQNSLNNARSAMATVMKISLVLFKSSGLQPKLGAVNADLNSSERLLTQLTALVDCKAVHHNF 381
            |..|..:|...:..:|.:::  .|.::....:..|..|...||.:|..|..|||||||:::|.::
Human   311 LSGSHKALVEMQDVVAELLR--TVPWEQPATKDPLLRVQEVLNGTEVNLQHLTALVDCRSLHLDY 373

  Fly   382 LAAARGLCEGGLLGLVLMLIASFIAAILLTIMVWVDSHTWIYIRKRNDYAQVDEPSYISHPAP-Q 445
            :.|..|.|..|:.||:.:.:.||:.|::.:.:|....|||  .:||......:|.   :.|.| |
Human   374 VQALTGFCYDGVEGLIYLALFSFVTALMFSSIVCSVPHTW--QQKRGPDEDGEEE---AAPGPRQ 433

  Fly   446 NHQQM----MNAARTLPRNHNGHFSPPVISGSHTLQHPSKRQQHEMMAHAHIQQNMRAMGTHTLG 506
            .|..:    |.:..:...::....|.|  :.:||:   |.....|.|:.....||.|...|..:|
Human   434 AHDSLYRVHMPSLYSCGSSYGSETSIP--AAAHTV---SNAPVTEYMSQNANFQNPRCENTPLIG 493

  Fly   507 RLPSHNHSPTHMTGPNN-AAAVAAAANAAANMPPTTQA 543
            |     .||.    |:. .||:.:.::|.....|...|
Human   494 R-----ESPP----PSRYLAALDSGSHAGWQFKPMDSA 522

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ttyNP_542443.4 Tweety_N 10..429 CDD:143653 129/437 (30%)
TTYH3XP_011513837.1 Tweety 25..431 CDD:282726 123/433 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C45056311
eggNOG 1 0.900 E1_KOG4433
Hieranoid 1 1.000
Homologene 1 1.000 H18431
Inparanoid 1 1.050 196 1.000 Inparanoid score I3756
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D318605at33208
OrthoFinder 1 1.000 FOG0000756
OrthoInspector 1 1.000 T130239
orthoMCL 1 0.900 OOG5_134193
Panther 1 1.100 O PTHR12424
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.770

Return to query results.
Submit another query.