DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tty and ttyh3b

Sequence 1:NP_542443.4 Gene:tty FlyBaseID:FBgn0015558 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001032464.1 Gene:ttyh3b ZFINID:ZDB-GENE-051120-105 Length:560 Species:Danio rerio

Alignment Length:634 Identity:166/635 (26%)
Similarity:275/635 (43%) Gaps:118/635 (19%)


  Fly    11 YKVPVIAKLLHALPHYNITFHKINSTFRPNDEIYLESLGILGSVPAALLIVSLLGLLFYLMTRCC 75
            |..|....|.|.|||:|:.|.:.:|.|||:|..|.:::.:||:.....|.:.||.||||....||
Zfish     7 YSPPWWVNLFHRLPHFNLQFQQTSSDFRPDDSDYQKAVLLLGAAALVCLALDLLFLLFYSFWLCC 71

  Fly    76 DRKPR---PAHSITSLKVALSIVTVMCCAAIGLGLYGNDDLHNGLLEVLTAGRKVDNLVTTIRNQ 137
            .|:..   |..........:.|.|::|.|.|.:|.|||.:..:|:..:..:.|..:..|..|...
Zfish    72 CRRKNHDSPNADCCCTAWCVIIATLVCSAGIAVGFYGNGETCDGVTRLTYSLRHANQTVAGIDKL 136

  Fly   138 THILENTLTNRIRPQLVELADIFDQPVSNQTALSKLFVSL----NIVQGNVTLATNAASDIRRPL 198
            .....::|...:...||:|..::.:.....:.:.||...|    |::.|....::|         
Zfish   137 VSESTSSLNETLMEGLVQLETVYSKQTDYLSIVQKLQGQLDELINLMLGVPFWSSN--------- 192

  Fly   199 MGISMTHFLTRGDQWELIRWPGTVATLALLLVLCAVLLVGVARHSRCALILFSVC--GLLAVTGS 261
             .:|:.|..:..:|::..||.|.:..|...:::|.::|||:.|:||.  ||..||  |:|.:..|
Zfish   193 -DLSLDHLASITEQYDWYRWLGYLGLLLFDVIICLLVLVGLIRNSRS--ILIGVCFLGVLTLVIS 254

  Fly   262 WLMSGLYLSSSVAVGDLCISPADFLVSTAPRDLPTN--VLLHYTQCEPGHTNPFTQRLRESQNSL 324
            |...||..|.:|...|.|:||..::......:...|  :|.:|.:|..|.||||.|:|..|..:|
Zfish   255 WASLGLEFSFAVGASDFCVSPDSYITKVTRENAVINQDILQYYLKCSMGQTNPFQQKLSGSHKAL 319

  Fly   325 NNARSAMATVMKISLVLF--KSSGLQPKLGAVNADLNSSERLLTQLTALVDCKAVHHNFLAAARG 387
            ...:..::.:::.::..|  ..|.|:...|.    |||:|..|..|||||||:::|.:::.|..|
Zfish   320 VEMQDDVSELLRSAIRDFPKTKSNLEEMQGV----LNSTEVSLHHLTALVDCRSLHMDYVQALTG 380

  Fly   388 LCEGGLLGLVLMLIASFIAAILLTIMVWVDSHTWIYIRKRNDYAQVDEPSYISHPAPQNHQQMMN 452
            ||..|:.||:.:::.||:.|::.:.:|....|||  ..||::....||.|               
Zfish   381 LCYDGVEGLIYLVLFSFVTALMFSSIVCSVPHTW--QSKRSEEEDGDETS--------------- 428

  Fly   453 AARTLPRNHNGHFSPPVISGSHTLQHPSKRQQHEMMAHAHIQQNMRAMGTHTLGRLPSHNHSPTH 517
              .||              ||        |..|:.:...|: .::.:.|:.|.|           
Zfish   429 --ATL--------------GS--------RAPHDNLYRVHM-PSLYSCGSSTYG----------- 457

  Fly   518 MTGPNNAAAVAAAANAAANMPPTTQAAQQQQQQQAQQQQQQAQQQ--LG--GPQPIY-------- 570
                 |.|::.|||:..:|.|.|     :...|.|..|..:.:..  :|  .|.|.|        
Zfish   458 -----NEASLPAAAHTVSNAPVT-----EYMSQNANFQTPRCENTPLIGRESPPPSYTSSMRAKY 512

  Fly   571 --CHHPHQHPHP-------HPHQHPHSHSAAA----VAAAVQHQHAIYH 606
              ...|.| |.|       .|:..|...|.:|    ..:|:...|:..|
Zfish   513 LATSRPDQ-PRPTESQNGLEPNMRPDLTSRSAPNSRPNSAIHRPHSAIH 560

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ttyNP_542443.4 Tweety_N 10..429 CDD:143653 127/431 (29%)
ttyh3bNP_001032464.1 Tweety 26..430 CDD:282726 122/439 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C45060839
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H18431
Inparanoid 1 1.050 191 1.000 Inparanoid score I3785
OMA 1 1.010
OrthoDB 1 1.010 D318605at33208
OrthoFinder 1 1.000 FOG0000756
OrthoInspector 1 1.000 T128763
orthoMCL 1 0.900 OOG5_134193
Panther 1 1.100 O PTHR12424
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R7666
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.900

Return to query results.
Submit another query.