DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tty and ttyh1

Sequence 1:NP_542443.4 Gene:tty FlyBaseID:FBgn0015558 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001072899.1 Gene:ttyh1 XenbaseID:XB-GENE-940450 Length:536 Species:Xenopus tropicalis

Alignment Length:549 Identity:135/550 (25%)
Similarity:251/550 (46%) Gaps:51/550 (9%)


  Fly    19 LLHALPHYNITFHKINSTFRPNDEIYLESLGILGSVPAALLIVSLLGLLFYLMTRCC-------D 76
            :||.:||.|..|..:::.|.|.:..|.::|..|.|:....|.:||:.:..||:..||       |
 Frog    15 ILHQVPHTNFQFEVVDNQFAPQEWPYQQALLFLASIAGLCLAISLILICVYLIRFCCCSSQEDDD 79

  Fly    77 RKPRPAHSITSLKVALSIVTVMCCAAIGLGLYGNDDLHNGLLEVLTAGRKVDNLVTTIRNQTHIL 141
            .|   :|.:..:..:.....::|||.||:|.|||.:.::|:.:|..:....::.:|:|.......
 Frog    80 SK---SHRVCCVTWSCVAAVIICCAGIGIGFYGNSETNDGVYQVTYSLMNANHTLTSINLLISDT 141

  Fly   142 ENTLTNRIRPQLVELADIFDQPVSNQTALSKLFVSLNIVQGNVTLATNAASDIR-------RPLM 199
            ...|::.:|..|.:|.:||    |.:|   :..|.:...:..|.......::|.       .|..
 Frog   142 VELLSSVVRSDLTQLEEIF----SKRT---EFLVMIRNTRRQVESVAQQLAEISFWKGPEPNPNA 199

  Fly   200 GISMTHFLTRGDQWELIRWPGTVATLALLLVLCAVLLVGVARHSRCALILFSVCGLLAVTGSWLM 264
            .....:|:      |..||...:..|.|.|::|...|:|:|:..:..:|:.:|.....:..||..
 Frog   200 LAEQVNFI------EDYRWLAYILLLLLDLIICLFTLLGLAKQIKWLVIVMTVVSFFVLLLSWGS 258

  Fly   265 SGLYLSSSVAVGDLCISPADFLV--STAPRDLPTNVLLHYTQCEPGHTNPFTQRLRESQNSLNNA 327
            .||.::::|.:.|.|..|..:::  :.|..::..::|.:|..|....||||.|||..||.:|:|.
 Frog   259 MGLEMATAVGLSDFCSDPDAYVMNQTQAITNINPDILQYYISCNQDVTNPFRQRLTMSQRALSNI 323

  Fly   328 RSAMATVMKISLVLFKSSGLQPKLGAVNADLNSSERLLTQLTALVDCKAVHHNFLAAARGLCEGG 392
            .|.:..:.:.::..|.::  :..|..|...||::|.....|.||::|:.:|.:::.|.:|||..|
 Frog   324 HSQLHGLEREAVPQFPTA--EKNLLVVQGMLNTTEGNFHHLVALLNCRGLHKDYVDALKGLCYDG 386

  Fly   393 LLGLVLMLIASFIAAILLTIMVWVDSHTWIYIRKRN-DYAQVDEPSYISHPAPQNHQQMMNAART 456
            :.|::.:|:.||::|:..|..:......|...:.|: ||..:||....:   ||..::|::..  
 Frog   387 MEGILFLLLFSFLSALSFTAAICSLPRAWKRFQNRDLDYDDMDEDDPFN---PQARREMLHVT-- 446

  Fly   457 LPRNHNGHFSPPVISGSHTL-QHPSKRQQHEMMAHAHIQQNMR----AMGTHTLGRLP-SHNHSP 515
             .|.|    .|...|.|.:. .|.|.|.....:::|.:.|.|.    :.|......:| ....||
 Frog   447 -GRPH----LPSFYSYSSSCDSHSSLRVSAPPISNAPVSQYMNQSALSSGNPRFENIPLIDRQSP 506

  Fly   516 THMTGPNNAAAVAAAANAAANMPPTTQAA 544
            .....|:...:..:|.....:.|..|..|
 Frog   507 PPSYSPSMRTSFISATQEETDTPCRTDVA 535

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ttyNP_542443.4 Tweety_N 10..429 CDD:143653 108/427 (25%)
ttyh1NP_001072899.1 Tweety 26..421 CDD:309852 102/413 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C45054456
eggNOG 1 0.900 E1_KOG4433
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 190 1.000 Inparanoid score I3661
OMA 1 1.010
OrthoDB 1 1.010 D318605at33208
OrthoFinder 1 1.000 FOG0000756
OrthoInspector 1 1.000 T129278
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
109.770

Return to query results.
Submit another query.