DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tty and TTYH1

Sequence 1:NP_542443.4 Gene:tty FlyBaseID:FBgn0015558 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001005367.1 Gene:TTYH1 HGNCID:13476 Length:460 Species:Homo sapiens

Alignment Length:456 Identity:124/457 (27%)
Similarity:213/457 (47%) Gaps:55/457 (12%)


  Fly    11 YKVPVIAKLLHALPHYNITFHKINSTFRPNDEIYLESLGILGSVPAALLIVSLLGLLFYLMTRCC 75
            |:......|||.||..:.....:.|.|.|.::.|.::|.::.::....|.:||:.:..||:..||
Human     7 YRPSAWVHLLHQLPRADFQLRPVPSVFAPQEQEYQQALLLVAALAGLGLGLSLIFIAVYLIRFCC 71

  Fly    76 DRKPRPAHSITSLKVAL---SIVTVMC-------CAAIGLGLYGNDDLHNGLLEVLTAGRKVDNL 130
            .|.|.|..|    |:..   ..||..|       |..||:|.|||.:..:|:.::.:|....::.
Human    72 CRPPEPPGS----KIPSPGGGCVTWSCIVALLAGCTGIGIGFYGNSETSDGVSQLSSALLHANHT 132

  Fly   131 VTTIRNQTHILENT---LTNRIRPQLVELADIFDQPVSNQTALSKLFVSLNIVQGNVTLATNAAS 192
            ::||   .|::..|   |...:|.:|..|.::. :|.:...|.::         |....|..||.
Human   133 LSTI---DHLVLETVERLGEAVRTELTTLEEVL-EPRTELVAAAR---------GARRQAEAAAQ 184

  Fly   193 DIR----------RPLMGISMTHFLTRGDQWELIRWPGTVATLALLLVLCAVLLVGVARHSRCAL 247
            .::          .||.......|:      |..||...|..|.|.|::|...|:|:|:.|:..:
Human   185 QLQGLAFWQGVPLSPLQVAENVSFV------EEYRWLAYVLLLLLELLVCLFTLLGLAKQSKWLV 243

  Fly   248 ILFSVCGLLAVTGSWLMSGLYLSSSVAVGDLCISPADFLVSTAPRD--LPTNVLLHYTQCEPGHT 310
            |:.:|..||.:..||...||..:::|.:.|.|.:|..::::....:  |.:::|.:|..|....:
Human   244 IVMTVMSLLVLVLSWGSMGLEAATAVGLSDFCSNPDPYVLNLTQEETGLSSDILSYYLLCNRAVS 308

  Fly   311 NPFTQRLRESQNSLNNARSAMATVMKISLVLFKSSGLQPKLGAVNADLNSSERLLTQLTALVDCK 375
            |||.|||..||.:|.|..|.:..:.:.::..|.|:  |..|.::...||.:|....||.||:.|:
Human   309 NPFQQRLTLSQRALANIHSQLLGLEREAVPQFPSA--QKPLLSLEETLNVTEGNFHQLVALLHCR 371

  Fly   376 AVHHNFLAAARGLCEGGLLGLVLMLIASFIAAILLTIMVWVDSHTWIYIRKRNDYA-----QVDE 435
            ::|.::.||.|||||..|.||:.:|:.|.::|..|...:......|.....||..|     ::.|
Human   372 SLHKDYGAALRGLCEDALEGLLFLLLFSLLSAGALATALCSLPRAWALFPPRNPSALCSGSRLSE 436

  Fly   436 P 436
            |
Human   437 P 437

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ttyNP_542443.4 Tweety_N 10..429 CDD:143653 121/443 (27%)
TTYH1NP_001005367.1 Tweety_N 6..425 CDD:143653 121/443 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C45058038
eggNOG 1 0.900 E1_KOG4433
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 196 1.000 Inparanoid score I3756
Isobase 1 0.950 0 Normalized mean entropy S7304
OMA 1 1.010
OrthoDB 1 1.010 D318605at33208
OrthoFinder 1 1.000 FOG0000756
OrthoInspector 1 1.000 T130239
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12424
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.820

Return to query results.
Submit another query.