DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tty and Ttyh3

Sequence 1:NP_542443.4 Gene:tty FlyBaseID:FBgn0015558 Length:970 Species:Drosophila melanogaster
Sequence 2:XP_017453809.1 Gene:Ttyh3 RGDID:1309549 Length:530 Species:Rattus norvegicus

Alignment Length:540 Identity:149/541 (28%)
Similarity:245/541 (45%) Gaps:42/541 (8%)


  Fly    11 YKVPVIAKLLHALPHYNITFHKINSTFRPNDEIYLESLGILGSVPAALLIVSLLGLLFYLMTRCC 75
            |..|....|||.|||:::.:...:|.|||.|..|.::|.:||:...|.|.:.||.||||....||
  Rat     6 YAAPWWVSLLHRLPHFDLRWEATSSQFRPEDADYQQALLLLGAAALACLALDLLFLLFYSFWLCC 70

  Fly    76 DRKPRPAH---SITSLKVALSIVTVMCCAAIGLGLYGNDDLHNGLLEVLTAGRKVDNLVTTIRNQ 137
            .|:....|   ........:.|.|::|.|.|.:|.|||.:..:|:.....:.|..:..|..::::
  Rat    71 RRRKTDEHLDADCCCTAWCVIIATLVCSAGIAVGFYGNGETSDGVHRATYSLRHANRTVAGVQDR 135

  Fly   138 THILENTLTNRIRPQLVELADIFDQPVSNQTALSKLFVSLNIVQGNVTLATNAASDIRRPLMGIS 202
            .......|.....|.|..|    ::.::.:....:....|..:.|.:...|.|....|.|  |:|
  Rat   136 VWDTAAALNRTAEPNLQSL----EKQLAGRPEPLRAVQRLQTLLGTLLGYTAAIPFWRNP--GVS 194

  Fly   203 MTHFLTRGDQWELIRWPGTVATLALLLVLCAVLLVGVARHSRCALILFSVCGLLAVTGSWLMSGL 267
            :.....:.|.::..||.|.:..|.|.:::|.::|||:.|.|:..|:...:.|:||:..||...||
  Rat   195 LEVLAEQVDLYDWYRWLGYLGLLLLDVIICLLVLVGLIRSSKGILVGVCLLGVLALVISWGALGL 259

  Fly   268 YLSSSVAVGDLCISPADFLVSTAPR--DLPTNVLLHYTQCEPGHTNPFTQRLRESQNSLNNARSA 330
            .|:.||...|.||.|..|:......  .|..::|.:|..|.|..||||.|:|..|..:|...:..
  Rat   260 ELAVSVGSSDFCIDPDTFVTKMVEEYSVLSGDILQYYLACSPRATNPFQQKLSGSHKALVEMQDV 324

  Fly   331 MATVMKISLVLFKSSGLQPKLGAVNADLNSSERLLTQLTALVDCKAVHHNFLAAARGLCEGGLLG 395
            :|.::|  .|..:....:..|..|...||.:|..|..|||||||:::|.:::.|..|.|..|:.|
  Rat   325 VAELLK--NVPREHPATKDPLLRVQEVLNGTEVNLQHLTALVDCRSLHLDYVQALTGFCYDGVEG 387

  Fly   396 LVLMLIASFIAAILLTIMVWVDSHTWIYIRKRNDYAQVDEPSYISHPAP-QNHQQM----MNAAR 455
            |:.:.:.||:.|::.:.:|....|||...|..::..:.:     :.|.| |.|..:    |.:..
  Rat   388 LIYLALFSFVTALMFSSIVCSIPHTWQQKRGADEDGEEE-----TAPGPRQAHDSLYRVHMPSLY 447

  Fly   456 TLPRNHNGHFSPPVISGSHTLQHPSKRQQHEMMAHAHIQQNMRAMGTHTLGR-----------LP 509
            :...::....|.|  :.:||:   |.....|.|:.....||.|...|..:||           :|
  Rat   448 SCGSSYGSEASIP--AAAHTV---SNAPVTEYMSQNANFQNPRCENTPLIGRESPPPSVTLHAVP 507

  Fly   510 SHNHSPT---HMTGPNNAAA 526
            ....:|:   |...|..|.|
  Rat   508 CTLGAPSLQLHQAFPGTALA 527

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ttyNP_542443.4 Tweety_N 10..429 CDD:143653 125/423 (30%)
Ttyh3XP_017453809.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C45046883
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H18431
Inparanoid 1 1.050 187 1.000 Inparanoid score I3764
OMA 1 1.010
OrthoDB 1 1.010 D318605at33208
OrthoFinder 1 1.000 FOG0000756
OrthoInspector 1 1.000 T131252
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12424
Phylome 1 0.910 0.857 Consistency score
TreeFam 00.000 Not matched by this tool.
1010.010

Return to query results.
Submit another query.