DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tty and Ttyh1

Sequence 1:NP_542443.4 Gene:tty FlyBaseID:FBgn0015558 Length:970 Species:Drosophila melanogaster
Sequence 2:XP_017444381.1 Gene:Ttyh1 RGDID:1310103 Length:458 Species:Rattus norvegicus

Alignment Length:438 Identity:116/439 (26%)
Similarity:212/439 (48%) Gaps:34/439 (8%)


  Fly    11 YKVPVIAKLLHALPHYNITFHKINSTFRPNDEIYLESLGILGSVPAALLIVSLLGLLFYLMTRCC 75
            |:......|||.||..:.....:.|.|.|.|:.|.::|.::.::....|.:||:.:..||:..||
  Rat     7 YRPSAWVHLLHQLPRADFQLRPVPSGFAPRDQEYQQALLLVAALAGLGLGLSLIFIAVYLIRFCC 71

  Fly    76 DRKPRPAHS---------ITSLKVALSIVTVMCCAAIGLGLYGNDDLHNGLLEVLTAGRKVDNLV 131
            .|.|.|..:         :|...:|..:|.   ||.||:|.|||.:..:|:.::.:|.:..::.:
  Rat    72 CRPPEPPGAKSPPPGGGCVTWSCIAALLVG---CAGIGIGFYGNSETSDGVSQLSSALQHANHTL 133

  Fly   132 TTIRNQTHILENT--LTNRIRPQLVELADIFDQPVSNQTALSKLFVSLNIVQGNVTLATNAASDI 194
            :||.:.  :||..  |...:|.:|..|.::..:.|....|          .:|....|..||..:
  Rat   134 STIDDL--VLETVERLGEAVRTELTTLEEVLSERVELVAA----------TRGARRQAEAAAQHL 186

  Fly   195 RRPL--MGISMTHFLTRGDQW--ELIRWPGTVATLALLLVLCAVLLVGVARHSRCALILFSVCGL 255
            :...  .|:|::......|..  |..||...|..|.|:|::|...|:|:|:.|:..:::.:...|
  Rat   187 QGLAFWQGVSLSPVQVAEDVTFVEEYRWLAYVLLLLLVLLVCLFTLLGLAKQSKWLVVVMTAMSL 251

  Fly   256 LAVTGSWLMSGLYLSSSVAVGDLCISPADFLVSTAPRD--LPTNVLLHYTQCEPGHTNPFTQRLR 318
            |.:..||...||..:::|.:.|.|.:|..::::....:  :.:::|.:|..|....:|||.|||.
  Rat   252 LVLVLSWGSMGLEAATAVGLSDFCSNPDTYVLNLTQEETGISSDILNYYFLCNQAVSNPFQQRLT 316

  Fly   319 ESQNSLNNARSAMATVMKISLVLFKSSGLQPKLGAVNADLNSSERLLTQLTALVDCKAVHHNFLA 383
            .||.:|.:..|.:..:.:.:...|.::  |..|.::...||.:||...||.||:.|:::|.::.:
  Rat   317 LSQRALASIHSQLQGLEREASPQFPAA--QKPLLSLEETLNVTERSFHQLVALLHCRSLHKDYGS 379

  Fly   384 AARGLCEGGLLGLVLMLIASFIAAILLTIMVWVDSHTWIYIRKRNDYA 431
            |.|||||..|.||:.:::.|.::|..|...:......|.....||..|
  Rat   380 ALRGLCEDALEGLLFLMLFSLLSAGALATTLCSLPRAWALFPPRNPSA 427

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ttyNP_542443.4 Tweety_N 10..429 CDD:143653 115/435 (26%)
Ttyh1XP_017444381.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C45063962
eggNOG 1 0.900 E1_KOG4433
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 187 1.000 Inparanoid score I3764
OMA 1 1.010
OrthoDB 1 1.010 D318605at33208
OrthoFinder 1 1.000 FOG0000756
OrthoInspector 1 1.000 T131252
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12424
Phylome 1 0.910 0.857 Consistency score
TreeFam 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.