DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1486 and LOC102724985

DIOPT Version :8

Sequence 1:NP_608450.1 Gene:CG1486 / 33108 FlyBaseID:FBgn0031174 Length:852 Species:Drosophila melanogaster
Sequence 2:XP_016885689.1 Gene:LOC102724985 / 102724985 -ID:- Length:835 Species:Homo sapiens

Alignment Length:893 Identity:260/894 (29%)
Similarity:409/894 (46%) Gaps:154/894 (17%)


  Fly     3 AAGRS-VDDPGQSPLVDQEPDPGQSTPAVAEIAASSIRSGLAELELRSSQVLQRLENVKVSTTPE 66
            |||:| |::|           ||...|:.|.     :|.|....::....:.:..:|:|.:....
Human    26 AAGKSLVNNP-----------PGILPPSPAH-----VREGRRGAQIADPTLAEMGKNLKEAVKML 74

  Fly    67 SPNPVENEEEAGERVTSEDLLPAKHRVPSDILKSLEQLVS---YTDSDDDPEFP-LPALDDVSHL 127
            ..:....|||.|:::.|.| :|...:.....:.|:.|||.   :.|.|::|:.| :..:.:..|:
Human    75 EDSQRRTEEENGKKLISGD-IPGPLQGSGQDMVSILQLVQNLMHGDEDEEPQSPRIQNIGEQGHM 138

  Fly   128 ALISHSIVAYLSHLDRQQLLRVTNSISGDATRWLGTLFHFAHPASSFHADNADAVLRTVRLAIVA 192
            ||:.||:.||:|.||:::|.::|..|..|.|.||..:|.:.:..:.||.:..:.:.:..||||.:
Human   139 ALLGHSLGAYISTLDKEKLRKLTTRILSDTTLWLCRIFRYENGCAYFHEEEREGLAKICRLAIHS 203

  Fly   193 RCPGYLEGGIPAL--AQPTFYISENTTPMRLHYACRQLGIPLEAIKVIPEHSQSGT---MDVTLL 252
            |...::..|...|  .:|..|:|....|....|.|.|||:|...:..:|.::..|:   |||..|
Human   204 RYEDFVVDGFNVLYNKKPVIYLSAAARPGLGQYLCNQLGLPFPCLCRVPCNTVFGSQHQMDVAFL 268

  Fly   253 QKQIQQDVGNNRTPLLVVADIGASLCGYVDNLLRLRDVCKAHNMWLHASGHGLAALVCAQNQGHV 317
            :|.|:.|:...|.|||:||:.|.:..|:.|.:.||:::|:.:.:|||..|..||.|..    |:|
Human   269 EKLIKDDIERGRLPLLLVANAGTAAVGHTDKIGRLKELCEQYGIWLHVEGVNLATLAL----GYV 329

  Fly   318 EEVL------HSMALNLGSWLGVPSLPIVLLHRPLQNSALSAFESDPIL-----------SRRLN 365
            ...:      .||.:..|.|||:|::|.|.|::          ..||.|           :.:|.
Human   330 SSSVLAAAKCDSMTMTPGPWLGLPAVPAVTLYK----------HDDPALTLVAGLTSNKPTDKLR 384

  Fly   366 ALSLWTSLQALGRKAIAERLHVAFQTCSILFEIASKCEGIRVLSHTPGAQTGASLSDVIQSPFDV 430
            ||.||.|||.||.....||:..|.|....|.|...|...|::|           :.|.:.|    
Human   385 ALPLWLSLQYLGLDGFVERIKHACQLSQRLQESLKKVNYIKIL-----------VEDELSS---- 434

  Fly   431 QALFDAAAPVVAYQFDGSTTIPLGGSGSSAAAAAAERETAEGLKPLEKINNASYFDRLNSWLGQI 495
                    |||.::|...    |.||.....|......|..|:.     ......|.||.|||:.
Human   435 --------PVVVFRFFQE----LPGSDPVFKAVPVPNMTPSGVG-----RERHSCDALNRWLGEQ 482

  Fly   496 LQRDCPNFDFEVIEHPTHGSCIRYCPLELG--LGEQPPSSENLESFAQSLEAHVDILRATIKHKA 558
            |::..|.....|::....|:|:|:.||...  ||.:   .|:::.....:|:.:.:|..|::.:.
Human   483 LKQLVPASGLTVMDLEAEGTCLRFSPLMTAAVLGTR---GEDVDQLVACIESKLPVLCCTLQLRE 544

  Fly   559 RFIHLVECSDVLRLVPLPEWAGMGGVRFV------------PEGWESLLTDQAKTELNKLNIDLV 611
            .|...||.:..|..|..|.|:|:|.||:.            ||| |::.....| :||:|..|| 
Human   545 EFKQEVEATAGLLYVDDPNWSGIGVVRYEHANDDKSSLKSDPEG-ENIHAGLLK-KLNELESDL- 606

  Fly   612 EALKSTDNAFSLG-EGTDGLICVRFGMVTHETEVEELLDLVVTVGKSVQENSRVLDTMSEIVKKG 675
                    .|.:| |......|:..||.:...:..||::.:....:.::||||:|:.|:|:|:||
Human   607 --------TFKIGPEYKSMKSCLYVGMASDNVDAAELVETIAATAREIEENSRLLENMTEVVRKG 663

  Fly   676 IEAVTADLQRESEEKLWQEGILRHVPVVGRVFNWWSPPAKESGIKGRSLNLTQGVVESTENIYKY 740
            |:....:||:.|||:|.:||:||.:||||.|.||:||  .::..|||:.|||.|.:||||.||.|
Human   664 IQEAQVELQKASEERLLEEGVLRQIPVVGSVLNWFSP--VQALQKGRTFNLTAGSLESTEPIYVY 726

  Fly   741 HMQMTGATAHQLPANRSPPTPMVQTPVVAPALPPVFPTVEPVPGNGNGSGA-SEGTPV------- 797
            ..|..|.|.        ||||.      ........|..:|...:..||.| ||.:.|       
Human   727 KAQGAGVTL--------PPTPS------GSRTKQRLPGQKPFKRSLRGSDALSETSSVSHIEDLE 777

  Fly   798 -----QSGEASGSMPAASGAAPSAAPTQNHVDHARTVSQSSAASSTVP 840
                 .||....::.|:|......||:..|.|      |:.|....||
Human   778 KVERLSSGPEQITLEASSTEGHPGAPSPQHTD------QTEAFQKGVP 819

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1486NP_608450.1 AAT_I 159..>384 CDD:302748 76/247 (31%)
WWbp <725..801 CDD:304964 28/89 (31%)
LOC102724985XP_016885689.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 313 1.000 Inparanoid score I2533
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003744
OrthoInspector 1 1.000 T610018
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3010
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.