DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1722 and Y119C1B.1

DIOPT Version :8

Sequence 1:NP_608443.1 Gene:CG1722 / 33101 FlyBaseID:FBgn0031168 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_491388.1 Gene:Y119C1B.1 / 172056 WormBaseID:WBGene00022467 Length:273 Species:Caenorhabditis elegans

Alignment Length:161 Identity:33/162 (20%)
Similarity:64/162 (40%) Gaps:45/162 (28%)


  Fly    18 STKKLQSKVKSVGKTKPKMQQKSVKQPLKKPMRRSPLMRAALQPTILGLAKEKPVKKSRVTFK-- 80
            ::||.:..:||....|.|..:::.::..|....|:.:.|.::        |....:|||.:.|  
 Worm    45 NSKKSKKSMKSRKSMKSKRDRRTSERERKSSRDRNKVSRRSM--------KSSRDRKSRRSSKDR 101

  Fly    81 KSHR---RPLDAMQSL----------------GMSRRTRLIDASPQRKAKGTSVLFLGKDSRTTK 126
            ||||   |..|....:                |.||:::....|.:.:.|..|:  ..:|.:|.:
 Worm   102 KSHRSSNRKRDREDDVRDGSRKGVRDGRSRKSGKSRKSQKSQKSTKLEKKKCSI--RSEDIKTPR 164

  Fly   127 MPKKMKPSSE--------------KPASEKN 143
            ...:.:|::|              ||:..:|
 Worm   165 HDSEYRPTNEVRSVYVATGQSTYSKPSKPEN 195

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1722NP_608443.1 SNARE <76..103 CDD:304603 11/48 (23%)
Y119C1B.1NP_491388.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131131114
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
21.890

Return to query results.
Submit another query.