DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1724 and TIM17-3

Sequence 1:NP_608439.2 Gene:CG1724 FlyBaseID:FBgn0031164 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_196730.1 Gene:TIM17-3 AraportID:AT5G11690 Length:133 Species:Arabidopsis thaliana

Alignment Length:122 Identity:53/123 (43%)
Similarity:76/123 (62%) Gaps:2/123 (2%)


  Fly     5 SREPCPFRIVDDCGGAFTMGCFGGGLFQGLKGFRNAPQGLKRRFAGGLAAVKSRSPTIGGNFAAW 69
            |:|...:|||:..|.||..|..||.::..::|..|:|.|  .|:.||..|....:|.:||.||.:
plant     7 SKEHGLYRIVNAIGYAFGAGAVGGSVYHFVRGAYNSPIG--ARYVGGTQAASMNAPRLGGTFAVF 69

  Fly    70 GCVFSIVDCSLVHLRKKEDPWNSIMSGAIAGGILSSRNGVAAMFGSAIIGGVLLSMI 126
            |.:.|..|.:||.:||||||||||::||..||:||.|.||.|...||::.|..|:::
plant    70 GGLLSTFDYALVRIRKKEDPWNSIVAGAATGGVLSIRKGVVAASTSAVMFGFFLAVL 126

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1724NP_608439.2 Tim17 1..147 CDD:295283 53/123 (43%)
TIM17-3NP_196730.1 Tim17 13..>126 CDD:295283 51/115 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1590221at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10485
Phylome 1 0.910 0.667 Consistency score
33.020

Return to query results.
Submit another query.