DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1724 and TIM17-3

DIOPT Version :9

Sequence 1:NP_608439.2 Gene:CG1724 / 33097 FlyBaseID:FBgn0031164 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_196730.1 Gene:TIM17-3 / 831041 AraportID:AT5G11690 Length:133 Species:Arabidopsis thaliana


Alignment Length:122 Identity:53/122 - (43%)
Similarity:76/122 - (62%) Gaps:2/122 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SREPCPFRIVDDCGGAFTMGCFGGGLFQGLKGFRNAPQGLKRRFAGGLAAVKSRSPTIGGNFAAW 69
            |:|...:|||:..|.||..|..||.::..::|..|:|.|  .|:.||..|....:|.:||.||.:
plant     7 SKEHGLYRIVNAIGYAFGAGAVGGSVYHFVRGAYNSPIG--ARYVGGTQAASMNAPRLGGTFAVF 69

  Fly    70 GCVFSIVDCSLVHLRKKEDPWNSIMSGAIAGGILSSRNGVAAMFGSAIIGGVLLSMI 126
            |.:.|..|.:||.:||||||||||::||..||:||.|.||.|...||::.|..|:::
plant    70 GGLLSTFDYALVRIRKKEDPWNSIVAGAATGGVLSIRKGVVAASTSAVMFGFFLAVL 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1724NP_608439.2 Tim17 1..147 CDD:295283 53/122 (43%)
TIM17-3NP_196730.1 Tim17 13..>126 CDD:413300 51/114 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 130 1.000 Domainoid score I1702
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10485
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.