DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1724 and timm17b

Sequence 1:NP_608439.2 Gene:CG1724 FlyBaseID:FBgn0031164 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001107065.1 Gene:timm17b ZFINID:ZDB-GENE-081104-144 Length:167 Species:Danio rerio

Alignment Length:146 Identity:95/147 (65%)
Similarity:118/147 (80%) Gaps:0/147 (0%)


  Fly     1 MEEYSREPCPFRIVDDCGGAFTMGCFGGGLFQGLKGFRNAPQGLKRRFAGGLAAVKSRSPTIGGN 65
            ||||:|||||:|||||||||||||..|||:||.:|||||||.|::.|..|...||:.|:|.|||:
Zfish     1 MEEYAREPCPWRIVDDCGGAFTMGAIGGGVFQTVKGFRNAPVGVRHRLRGSANAVRVRAPQIGGS 65

  Fly    66 FAAWGCVFSIVDCSLVHLRKKEDPWNSIMSGAIAGGILSSRNGVAAMFGSAIIGGVLLSMIEGVG 130
            ||.||.:||.:||.||.||.||||||||.|||:.|.||::|:|..||.|||::||:||::|||.|
Zfish    66 FAVWGGLFSTIDCGLVRLRGKEDPWNSITSGAMTGAILAARSGPLAMVGSAMMGGILLALIEGFG 130

  Fly   131 ILFTRISAEQFRNSDP 146
            ||.||.:|:||:||.|
Zfish   131 ILLTRYTAQQFQNSSP 146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1724NP_608439.2 Tim17 1..147 CDD:295283 95/147 (65%)
timm17bNP_001107065.1 Tim17 1..167 CDD:295283 95/147 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C274774861
eggNOG 1 0.900 E1_COG5596
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 223 1.000 Inparanoid score I3434
OMA 1 1.010
OrthoDB 1 1.010 D1590221at2759
OrthoFinder 1 1.000 FOG0000724
OrthoInspector 1 1.000 T128725
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10485
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.