DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1724 and Timm23

Sequence 1:NP_608439.2 Gene:CG1724 FlyBaseID:FBgn0031164 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_062225.1 Gene:Timm23 RGDID:3863 Length:209 Species:Rattus norvegicus

Alignment Length:116 Identity:26/117 (22%)
Similarity:42/117 (36%) Gaps:14/117 (12%)


  Fly    21 FTMG--CFGGGLFQGLKGFRNAPQGLKR---------RFAGGLAAVKSRSPTIGGNFAAWGCVFS 74
            ||:|  |..|..|..|.|.|   .|||.         |....|..|..:.........:...::|
  Rat    78 FTIGGCCMTGAAFGALNGLR---LGLKETQSMPWSKPRNVQILNMVTRQGALWANTLGSLALLYS 139

  Fly    75 IVDCSLVHLRKKEDPWNSIMSGAIAGGILSSRNGVAAMFGSAIIGGVLLSM 125
            .....:...|..||.:|::.:|.:.|.:.....|:..:....:.|..|.|:
  Rat   140 AFGVIIEKTRGAEDDFNTVAAGTMTGMLYKCTGGLRGIARGGLAGLTLTSV 190

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1724NP_608439.2 Tim17 1..147 CDD:295283 26/117 (22%)
Timm23NP_062225.1 3a0801s02tim23 46..191 CDD:130056 26/117 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.