DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1724 and Timm17a

Sequence 1:NP_608439.2 Gene:CG1724 FlyBaseID:FBgn0031164 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_062224.1 Gene:Timm17a RGDID:3862 Length:171 Species:Rattus norvegicus

Alignment Length:172 Identity:99/173 (57%)
Similarity:124/173 (72%) Gaps:10/173 (6%)


  Fly     1 MEEYSREPCPFRIVDDCGGAFTMGCFGGGLFQGLKGFRNAPQGLKRRFAGGLAAVKSRSPTIGGN 65
            ||||:|||||:|||||||||||||..|||:||..|||||:|.|:..|..|.|.|:|:|:|.:||:
  Rat     1 MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAFKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGS 65

  Fly    66 FAAWGCVFSIVDCSLVHLRKKEDPWNSIMSGAIAGGILSSRNGVAAMFGSAIIGGVLLSMIEGVG 130
            ||.||.:||.:||.:|.:|.||||||||.|||:.|.||::|||..||.|||.:||:||::|||.|
  Rat    66 FAVWGGLFSTIDCGMVQIRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAG 130

  Fly   131 ILFTRISAEQFRNSDPQNDLGRAGAFASG-SGMGSGDINSSP 171
            ||.||.::.||.|. ||        ||.. |.:.|..:.|||
  Rat   131 ILLTRFASAQFPNG-PQ--------FAEDHSQLPSSQLPSSP 163

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1724NP_608439.2 Tim17 1..147 CDD:295283 91/146 (62%)
Timm17aNP_062224.1 3a0801so1tim17 1..171 CDD:130053 99/173 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C274771684
eggNOG 1 0.900 E1_COG5596
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 225 1.000 Inparanoid score I3355
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1590221at2759
OrthoFinder 1 1.000 FOG0000724
OrthoInspector 1 1.000 T131223
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10485
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
109.860

Return to query results.
Submit another query.