DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1724 and Tim17b1

Sequence 1:NP_608439.2 Gene:CG1724 FlyBaseID:FBgn0031164 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_649526.2 Gene:Tim17b1 FlyBaseID:FBgn0037310 Length:179 Species:Drosophila melanogaster

Alignment Length:177 Identity:99/178 (56%)
Similarity:125/178 (70%) Gaps:7/178 (4%)


  Fly     1 MEEYSREPCPFRIVDDCGGAFTMGCFGGGLFQGLKGFRNAPQGLKRRFAGGLAAVKSRSPTIGGN 65
            |.||.|||||||||:||||||.||..|||.||.:|||||||.||..|.:||||||::||..:|||
  Fly     1 MAEYGREPCPFRIVEDCGGAFAMGALGGGAFQAIKGFRNAPSGLGYRLSGGLAAVRARSGLVGGN 65

  Fly    66 FAAWGCVFSIVDCSLVHLRKKEDPWNSIMSGAIAGGILSSRNGVAAMFGSAIIGGVLLSMIEGVG 130
            ||.||..||.:|||||:.||||||||:|:|||..||||::|.|:.:|..||::||.||::|||||
  Fly    66 FAVWGATFSAIDCSLVYFRKKEDPWNAIISGATTGGILAARTGLTSMLSSALVGGALLALIEGVG 130

  Fly   131 ILFTRISAEQFRNSDP-------QNDLGRAGAFASGSGMGSGDINSS 170
            |:.:..||:.:|...|       :.:|.|.....|......|:|:||
  Fly   131 IVVSHYSADSYRQVSPVERQQRYKQELLRQQKGVSPLAATYGEIDSS 177

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1724NP_608439.2 Tim17 1..147 CDD:295283 92/153 (60%)
Tim17b1NP_649526.2 Tim17 1..147 CDD:295283 92/146 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C274751469
eggNOG 1 0.900 E1_COG5596
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I1516
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1590221at2759
OrthoFinder 1 1.000 FOG0000724
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10485
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.