DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1724 and timm17a

Sequence 1:NP_608439.2 Gene:CG1724 FlyBaseID:FBgn0031164 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_938181.1 Gene:timm17a ZFINID:ZDB-GENE-031030-6 Length:166 Species:Danio rerio

Alignment Length:141 Identity:89/142 (63%)
Similarity:114/142 (80%) Gaps:0/142 (0%)


  Fly     1 MEEYSREPCPFRIVDDCGGAFTMGCFGGGLFQGLKGFRNAPQGLKRRFAGGLAAVKSRSPTIGGN 65
            ||||:|||||:|||||||||||||..|||:||.:|||||:|.|:..|..|.|.|:::|:|.:||:
Zfish     1 MEEYAREPCPWRIVDDCGGAFTMGAIGGGIFQAVKGFRNSPSGMNHRMKGSLTAIRTRAPQLGGS 65

  Fly    66 FAAWGCVFSIVDCSLVHLRKKEDPWNSIMSGAIAGGILSSRNGVAAMFGSAIIGGVLLSMIEGVG 130
            ||.||.:||::||.||.:|.||||||||.|||:.|.||::|||..||.|||.:||:||::|||.|
Zfish    66 FAVWGGLFSMIDCGLVKVRGKEDPWNSITSGAMTGAILAARNGPVAMVGSAAMGGILLALIEGAG 130

  Fly   131 ILFTRISAEQF 141
            ||.||.::.||
Zfish   131 ILLTRFASAQF 141

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1724NP_608439.2 Tim17 1..147 CDD:295283 89/142 (63%)
timm17aNP_938181.1 Tim17 1..166 CDD:295283 89/142 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C274773977
eggNOG 1 0.900 E1_COG5596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1590221at2759
OrthoFinder 1 1.000 FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10485
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.