DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1724 and CG31229

Sequence 1:NP_608439.2 Gene:CG1724 FlyBaseID:FBgn0031164 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_732364.1 Gene:CG31229 FlyBaseID:FBgn0051229 Length:195 Species:Drosophila melanogaster

Alignment Length:121 Identity:39/122 (32%)
Similarity:52/122 (43%) Gaps:20/122 (16%)


  Fly    14 VDDCGGAFTMGCFGG-------GLFQG------LKGFRNAPQGLKRRFAGGLAAVKSRSPTIGGN 65
            |:.||...||.|..|       |||..      ...|.|..:...|..   ...::|.:.:...|
  Fly    66 VESCGFKCTMACVMGYGLGAALGLFSASVNPNMADPFANEKKQTAREV---FREMRSTTHSYAKN 127

  Fly    66 FAAWGCVFSIVDCSLVHLRKKEDPWNSIMSGAIAGGILSSRNGVAAMFGSAIIGGV 121
            ||..|||||.|:|::...|...|..|...:|.|.||::..|.||.|    .||||:
  Fly   128 FALIGCVFSAVECTIESHRGVTDWKNGTYAGGITGGLIGLRAGVKA----GIIGGL 179

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1724NP_608439.2 Tim17 1..147 CDD:295283 39/122 (32%)
CG31229NP_732364.1 Tim17 68..189 CDD:280604 38/120 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5596
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.