powered by:
                  
 
    
 
    
             
          
            Protein Alignment CG1724 and TIMM22
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_608439.2 | 
            Gene: | CG1724 / 33097 | 
            FlyBaseID: | FBgn0031164 | 
            Length: | 185 | 
            Species: | Drosophila melanogaster | 
          
          
            | Sequence 2: | NP_037469.2 | 
            Gene: | TIMM22 / 29928 | 
            HGNCID: | 17317 | 
            Length: | 194 | 
            Species: | Homo sapiens | 
          
        
        
        
          
            | Alignment Length: | 131 | 
            Identity: | 40/131 - (30%) | 
          
          
            | Similarity: | 55/131 -  (41%) | 
            Gaps: | 21/131 - (16%) | 
          
        
      
- Green bases have known domain annotations that are detailed below.
      | 
 
  Fly     1 MEEYSREPCPFRIVDDCGGAFTMGCFGGGLFQGLK---GF--------RNAPQGLKRRFAGGLAA 54 
            |.|.:.|.|.|:....|.|.|.:|...|....|:.   ||        ..|.:.||.....|::. 
Human    61 MIEKAMESCAFKAALACVGGFVLGGAFGVFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQRGMSY 125 
 
  Fly    55 VKSRSPTIGGNFAAWGCVFSIVDCSLVHLRKKEDPWNSIMSGAIAGGILSSRNGVAAMFGSAIIG 119 
            .|        |||..|.:||..:|.:...|...|..||::||.|.||.:..|.|:.|  |:...| 
Human   126 AK--------NFAIVGAMFSCTECLIESYRGTSDWKNSVISGCITGGAIGFRAGLKA--GAIGCG 180 
 
  Fly   120 G 120 
            | 
Human   181 G 181 
 
       | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
          
          
            | Gene | Sequence | Domain | Region | 
            External ID | Identity | 
          
          
            | CG1724 | NP_608439.2 | 
            Tim17 | 
            1..147 | 
            CDD:295283 | 
            40/131 (31%) | 
          
          
            | TIMM22 | NP_037469.2 | 
            Tim17 | 
            69..186 | 
            CDD:396842 | 
            37/123 (30%) | 
          
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | 
            Simple Score | 
            Weighted Score | 
            Original Tool Information | 
          
          
            | BLAST Result | 
            Score | 
            Score Type | 
            Cluster ID | 
          
          
          
            | Compara | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Domainoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | eggNOG | 
            1 | 
            0.900 | 
            - | 
            - | 
             | 
            E1_COG5596 | 
          
          
            | Hieranoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Homologene | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Inparanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Isobase | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OMA | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoDB | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoFinder | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoInspector | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | orthoMCL | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Panther | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Phylome | 
            1 | 
            0.910 | 
            - | 
            - | 
             | 
             | 
          
          
            | RoundUp | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SonicParanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SwiftOrtho | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | TreeFam | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | User_Submission | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
             | 
            2 | 1.810 | 
             | 
          
        
      
           
             Return to query results.
             Submit another query.