DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1724 and LOC100911130

Sequence 1:NP_608439.2 Gene:CG1724 FlyBaseID:FBgn0031164 Length:185 Species:Drosophila melanogaster
Sequence 2:XP_003752056.1 Gene:LOC100911130 RGDID:6494590 Length:172 Species:Rattus norvegicus

Alignment Length:164 Identity:101/165 (61%)
Similarity:127/165 (77%) Gaps:5/165 (3%)


  Fly     1 MEEYSREPCPFRIVDDCGGAFTMGCFGGGLFQGLKGFRNAPQGLKRRFAGGLAAVKSRSPTIGGN 65
            ||||:|||||:|||||||||||||..|||:||.:|||||||.|::.||.|.:.||:.|:|.|||:
  Rat     1 MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAVKGFRNAPVGIRHRFRGSINAVRIRAPQIGGS 65

  Fly    66 FAAWGCVFSIVDCSLVHLRKKEDPWNSIMSGAIAGGILSSRNGVAAMFGSAIIGGVLLSMIEGVG 130
            ||.||.:||.:||.||.||.||||||||.|||:.|.:|::|:|..||.|||::||:||::|||||
  Rat    66 FAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVG 130

  Fly   131 ILFTRISAEQFRNS-----DPQNDLGRAGAFASG 159
            ||.||.:|:||||:     ||.....:.||.|.|
  Rat   131 ILLTRYTAQQFRNAPPFLEDPNQLTPKEGAPAPG 164

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1724NP_608439.2 Tim17 1..147 CDD:295283 97/151 (64%)
LOC100911130XP_003752056.1 Tim17 1..171 CDD:295283 101/165 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C274776530
eggNOG 1 0.900 E1_COG5596
Hieranoid 1 1.000
Homologene 1 1.000 H135958
Inparanoid 1 1.050 225 1.000 Inparanoid score I3355
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1590221at2759
OrthoFinder 1 1.000 FOG0000724
OrthoInspector 1 1.000 T131223
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
TreeFam 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.