DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unc and T08D2.8

Sequence 1:NP_001285512.1 Gene:unc FlyBaseID:FBgn0003950 Length:1386 Species:Drosophila melanogaster
Sequence 2:NP_508061.1 Gene:T08D2.8 WormBaseID:WBGene00011613 Length:388 Species:Caenorhabditis elegans

Alignment Length:421 Identity:81/422 (19%)
Similarity:130/422 (31%) Gaps:170/422 (40%)


  Fly   599 PLPEKRESSVQTESTIPTASIATQTSRKSAHNESVITQTEQ-KQLKDAGNQASCEPPTFQKSYEQ 662
            ||....|:.:..::.......|...||..|.|:..|.:||: |||.:                  
 Worm    89 PLSAYSEAGLSNKNPQARQQTALFLSRFFAKNDPKIVETEEVKQLAE------------------ 135

  Fly   663 WIHEMLHSSSGQVFLERVELSLNKALE------LQKVRLNELFQVKLRHQAEMLRLSKRQNSWRT 721
              |.:..|:.....:.:..|.:..|::      :.|..|.|::..||:  .|.|         ..
 Worm   136 --HILKTSNDADKEVRKAALRIVAAVQKCLGEGVAKRLLAEVYHDKLK--TEKL---------PP 187

  Fly   722 LCKRVERDSQSSAEARDLVQQIFRLLEHYEAHHQQLAEKIQQTELAAEQAARIMPMWADGAAVGS 786
            |.:.:|::.:|||.     .::.||.:||:                                :||
 Worm   188 LIEELEKEFESSAS-----PEMLRLAKHYK--------------------------------IGS 215

  Fly   787 ASVNWNTAMSTTLISSGICTPPPAQPAADGALNVGKTHVEQHTYPDLGYPYQLLALAPPGGVPVA 851
            :|                 |..|.:.||                   |.|.:|.:...|...|  
 Worm   216 SS-----------------TSAPPKTAA-------------------GAPKRLSSAVAPRRAP-- 242

  Fly   852 GTFVPVTHLPAHLLGASEHPV------------PLVPVARIYSDPMKT--------SRRLLSPSS 896
                |.:..|.....:.:.||            |:.|||.:...|...        .|..::|:.
 Worm   243 ----PASAAPTRRAPSPKAPVVAPTRRAPSPKAPVAPVAPVKPKPFVARPAPNFGKPRAAVAPAR 303

  Fly   897 VPADNDSAHRAAGETNAFT--FQGGPVSGDLHPTENRNQAPATQGQQFPVPLPVPAPRGPSPSVQ 959
            .|   ....||...|...|  .:..|::    |...||.|||             |||.|   ::
 Worm   304 AP---QITQRAPAATRPATSAIRVIPIA----PNVVRNGAPA-------------APRKP---IE 345

  Fly   960 SVLPSTASPALPPPDETVPQPGPSQSSIPLK 990
            ...|.|:|        .:..||..:|.|..|
 Worm   346 IARPQTSS--------GIAAPGAPRSRIGTK 368

Known Domains:


GeneSequenceDomainRegion External IDIdentity
uncNP_001285512.1 LisH_2 225..252 CDD:292664
T08D2.8NP_508061.1 V-ATPase_H_C <116..164 CDD:288537 12/68 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.