DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unc and F54A3.2

Sequence 1:NP_001285512.1 Gene:unc FlyBaseID:FBgn0003950 Length:1386 Species:Drosophila melanogaster
Sequence 2:NP_494219.4 Gene:F54A3.2 WormBaseID:WBGene00018781 Length:748 Species:Caenorhabditis elegans

Alignment Length:735 Identity:135/736 (18%)
Similarity:246/736 (33%) Gaps:228/736 (31%)


  Fly   349 CVEARPEVDTTGLYQTEEHELILGADGRSVFVGGRVSQSLHSVEQQLNQLIKNLRHLAKSCAPPV 413
            |.:..|::.   ..:|....::..:....|.|..:..|:|.|:::.:...|              
 Worm   167 CRQCTPDIQ---FIKTIAPLIVKASSESDVTVRDKACQALGSIKRLIGDTI-------------- 214

  Fly   414 EVISSTKFEDLLMKELRERERL----LKAGQAFNPGEPVIKIATGDKEEEHEVTS-GRNQKDVVH 473
                 |.|...:..|..:.|::    .:|.:.|...:.....|.||...|:...: ..||::...
 Worm   215 -----TAFIGPISTETAKIEKINQYQQEAAEEFKKFQETQPKAGGDGGAENSAENLDENQENSPE 274

  Fly   474 SNLGPIQVPALDVTIPQ--------------LPRLHSEQLASLAVIRQSLEKVQKKSRQPQGRMY 524
            ....|..:.|.::..|:              :.:...|:||....:::|:|..        ||:.
 Worm   275 KAEKPQVLDAWELLEPEDCSKKIDKSVETQLIDKNWKERLAGAENVKKSMENA--------GRIE 331

  Fly   525 VSMERMETLMGDVCGCVQLLSNVLNLSMEQEHSVGMHKGFKWGYREGFAHGHFMGLQEGQKLEQL 589
            :| ||:..           :|.:|...:|::.:|.                  :|....|.|.::
 Worm   332 IS-ERLTE-----------ISKLLMKIVEKDVNVN------------------VGAISAQILAEI 366

  Fly   590 EQKKWQKERPL----------PEKRESSVQTESTIPTASIATQTSRKSAHNESVITQTEQKQLKD 644
            .:|......||          ..|.:.::..::.:.....|..|:..||::|:|||....|. ..
 Worm   367 AKKSRFSFAPLALRAFPVVFDKLKDKKAILRDALVEFCDEAANTTPLSAYSEAVITALSNKN-PQ 430

  Fly   645 AGNQ---------ASCEPPTFQKSYEQWIHEMLHSSSGQVFLERVELSLNKALELQKV------- 693
            |..|         |..:|.|.:....:.:.|.:..:|.....|..|.:|.....:||.       
 Worm   431 ARQQTALFLSRFFAKNDPKTVETEAVKQLAEHILKTSNDADKEVREAALRIVAAVQKCLGEGVAK 495

  Fly   694 -RLNELFQVKLRHQAEMLRLSKRQNSWRTLCKRVERDSQSSAEARDLVQQIFRLLEHYEAHHQQL 757
             .|.|::..||:  ||.|         ..|.:.:|::..|||.     .::.||.:||:      
 Worm   496 RLLAEVYDDKLK--AEKL---------PPLIEELEKEFGSSAS-----PEMLRLAKHYK------ 538

  Fly   758 AEKIQQTELAAEQAARIMPMWADGAAVGSASVNWNTAMSTTLISSGICTPPPAQPAADGALNVGK 822
                                      :|::|.                :.||...||        
 Worm   539 --------------------------IGASST----------------SAPPKTTAA-------- 553

  Fly   823 THVEQHTYPDLGYPYQLLALAPPGGVPVAGTFVPVTHLP---AHLLGASEH-PVPLVPVARIYSD 883
                       |.|.:..:...|...|.|.. .|....|   |.::..:.. |.|..|||.:  .
 Worm   554 -----------GAPKRPSSAVAPRRAPPASA-APTRRAPSPKAPVVAPTRRAPSPKAPVASV--A 604

  Fly   884 PMKTS-------------RRLLSPSSVPADNDSAHRAAGETNAFTFQGGPVSGDLHPTENRNQAP 935
            |:|..             |..::|:..|.....| .||...:....:..|::    |...||.||
 Worm   605 PVKPKPFVARPAPSFGKPRAAVAPARAPQITQRA-PAATRPSTSAIRVTPIA----PNVVRNGAP 664

  Fly   936 ATQGQQFPVPLPVPAPRGPS-------PSVQSVLPSTASPALPPPDETVPQPGPSQSSIPLKPSM 993
            .|..|....|:.:..|:..|       |..:..:|:|:|.:|      ..:||.:.||:|..|:.
 Worm   665 TTAQQAPRKPIGIARPQTSSGIAAPGAPRSRIAMPTTSSSSL------ARRPGSASSSVPRVPTG 723

  Fly   994 HSVATNTITPVPPKATPLKP 1013
            .:..|::....||.....:|
 Worm   724 AASMTSSSRIRPPSRPGSRP 743

Known Domains:


GeneSequenceDomainRegion External IDIdentity
uncNP_001285512.1 LisH_2 225..252 CDD:292664
F54A3.2NP_494219.4 HEAT repeat 103..132 CDD:293787
HEAT repeat 138..164 CDD:293787
HEAT repeat 177..206 CDD:293787 6/29 (21%)
HEAT repeat 301..325 CDD:293787 4/24 (17%)
HEAT repeat 335..371 CDD:293787 9/65 (14%)
HEAT repeat 380..402 CDD:293787 1/22 (5%)
Treslin_N <387..>489 CDD:291938 22/103 (21%)
HEAT repeat 413..442 CDD:293787 9/30 (30%)
HEAT repeat 453..485 CDD:293787 5/32 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.