DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1503 and Den1

DIOPT Version :8

Sequence 1:NP_001285511.1 Gene:CG1503 / 33090 FlyBaseID:FBgn0031157 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001163126.1 Gene:Den1 / 36339 FlyBaseID:FBgn0033716 Length:249 Species:Drosophila melanogaster

Alignment Length:250 Identity:84/250 - (33%)
Similarity:131/250 - (52%) Gaps:20/250 - (8%)


  Fly    53 KGKNKNKIRDSKTSTSLALERGSGDGPHQLAEVSLVALRFMDISLRHSDVQLLQSANEGVNERLV 117
            :.:|.|:.|...|:.|...:.||.      ::...::|.|.|..||.||||||...: .:|::::
  Fly    15 QNQNTNRRRPRFTNNSFHTKMGSN------SKADPISLTFHDSCLRMSDVQLLHGPH-WLNDQIL 72

  Fly   118 AFYYAYLQHRRYRSELDLHFLNPGLAARLRHMNMRQLWAMVRDRRLNEKQFILVPLS---THPRP 179
            :|||.||.|.:|::..||||:.|.:...:::|..::|..::.......|.||...|:   |....
  Fly    73 SFYYEYLAHMKYKTNADLHFIAPEITQCMKYMGDQELKQLLDQSNTTGKPFIFFALNDNETTDAG 137

  Fly   180 HGHWSLLVISRPDSKFYHYDSLDNCHSPLAASVSETLRAPLEAWKFALVTGRCLQQERQAAGKEG 244
            ..||||||.|||:..|||:||..|.::..:..:...::..|..........|||||        .
  Fly   138 GSHWSLLVFSRPEKTFYHFDSYGNNNTGNSLELMNKIKDLLGVRMAKFRPMRCLQQ--------A 194

  Fly   245 SGRDPASGIHLMCMTDHVADYVARCGYATSSLLIAVDQIAAMRTHLVELIQSLGG 299
            :|.|  .|||::|||||:|||:.|.........:.:|.:.|.||.|::||.||||
  Fly   195 NGYD--CGIHVICMTDHIADYLNRYEVIDGLPSLHIDTVKAKRTELLKLILSLGG 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1503NP_001285511.1 Peptidase_C48 117..>205 CDD:304959 34/90 (38%)
Den1NP_001163126.1 Peptidase_C48 66..204 CDD:304959 46/147 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C150649217
eggNOG 1 0.900 E1_COG2828
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2125
Isobase 1 0.950 0 Normalized mean entropy S3849
OrthoDB 1 1.010 D1313098at2759
OrthoFinder 1 1.000 FOG0003201
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.