DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1503 and Senp8

DIOPT Version :8

Sequence 1:NP_001285511.1 Gene:CG1503 / 33090 FlyBaseID:FBgn0031157 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001012355.1 Gene:Senp8 / 315723 RGDID:1309955 Length:217 Species:Rattus norvegicus

Alignment Length:217 Identity:55/218 (25%)
Similarity:97/218 (44%) Gaps:18/218 (8%)


  Fly    88 VALRFMDISLRHSDVQLLQSANEGVNERLVAFYYAYLQHRRYRSELD-LHFLNPGLAARLRHMNM 151
            |.|.:||..||.|||.||...| .:|:.::.|.:.|....::....| :.|::|.:...::..:.
  Rat     4 VVLSYMDSLLRQSDVSLLDPPN-WLNDHIIGFAFEYFASSQFHDCSDHVCFISPEVTQFIKCTSS 67

  Fly   152 RQLWAM-VRDRRLNEKQFILVPLSTHPRPHG---HWSLLVISRPDSKFYHYDSLDNCHSPLAASV 212
            ....|| :....|..|:.:.:.::.:.....   ||||||..:..:.|:||||....:|..|..|
  Rat    68 PAEIAMFLEPLDLPHKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSIHAKQV 132

  Fly   213 SETLRAPL--EAWKFALVTGRCLQQERQAAGKEGSGRDPASGIHLMCMTDHVADYVARCGYATSS 275
            :|.|:|.|  :..|...|       |.:|..::.|   ...|::::|.|:.:...:.|....:..
  Rat   133 AEKLKAFLGSKGDKLVFV-------EEKAPAQQNS---YDCGMYVICNTEALCQNLFRRQPESPL 187

  Fly   276 LLIAVDQIAAMRTHLVELIQSL 297
            .|:....|...|....:||..|
  Rat   188 QLLTPTYITKKRGEWKDLIARL 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1503NP_001285511.1 Peptidase_C48 117..>205 CDD:304959 20/93 (22%)
Senp8NP_001012355.1 Protease 11..174 44/174 (25%)
Peptidase_C48 25..188 CDD:304959 38/174 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C150984441
eggNOG 1 0.900 E1_COG2828
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1313098at2759
OrthoFinder 1 1.000 FOG0003201
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.