DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1503 and nep2

DIOPT Version :8

Sequence 1:NP_001285511.1 Gene:CG1503 / 33090 FlyBaseID:FBgn0031157 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_595608.1 Gene:nep2 / 2540263 PomBaseID:SPBC32H8.02c Length:415 Species:Schizosaccharomyces pombe

Alignment Length:186 Identity:41/186 - (22%)
Similarity:77/186 - (41%) Gaps:25/186 - (13%)


  Fly    27 KPNAKGKVKEKGTDKEKGKFKAKGNGKGKNKNKIRDSKTSTSLALERGSGDGPHQLAEVSLVALR 91
            :|.:.|.....|:|....|.|.||..:....:....||:..|               ..:.:.|.
pombe    23 RPPSTGSSNSNGSDTASPKKKKKGFFRSLFGSSSSGSKSCGS---------------PFTRIWLE 72

  Fly    92 FMDISLRHSDVQLLQSANEGVNERLVAFYYAYLQH---RRYRSE-LDLHFLNPGLAARLRHM-NM 151
            :.::|||.:||...:.....::..:..||...|:.   :|.:.| ..::.|.|.:...|... |.
pombe    73 YFEVSLRKNDVDHFRPGYWILDTNIDFFYEIMLRQVLLKRPKEESQQIYLLRPAMVFFLAQAPNP 137

  Fly   152 RQLWAMVRDRRLNEKQFILVPLS-THP---RPHGHWSLLVISRPDSKFYHYDSLDN 203
            .::.:.: ...:.:..||.:|:: |:.   ....||||||:|......::|||:.|
pombe   138 LEIESAL-PPAMFDASFIFLPINDTNECGIESGSHWSLLVVSVEKGLGWYYDSMSN 192

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1503NP_001285511.1 Peptidase_C48 117..>205 CDD:304959 24/96 (25%)
nep2NP_595608.1 Peptidase_C48 90..272 CDD:304959 24/104 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003201
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR46468
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.