DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1503 and nep1

DIOPT Version :8

Sequence 1:NP_001285511.1 Gene:CG1503 / 33090 FlyBaseID:FBgn0031157 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_596375.2 Gene:nep1 / 2539808 PomBaseID:SPBC17D11.01 Length:420 Species:Schizosaccharomyces pombe

Alignment Length:240 Identity:61/240 - (25%)
Similarity:97/240 - (40%) Gaps:49/240 - (20%)


  Fly    86 SLVALRFMDISLRHSDVQLLQSAN-------EGVNERLVAFYYAYLQHRRYRSEL-DLHFLNPGL 142
            |...|...|:..:..||..|:..|       :.|:|.:     .:|....|.::. ::..|.|.|
pombe     4 SPTVLELFDVCFKQEDVDSLKKPNWFTDVSIDYVDELI-----EHLWFPSYPNQANEILLLRPSL 63

  Fly   143 AARLRH--MNMRQLWAMVRDRRLNEKQFILVP---LSTHPRPHG--HWSLLVISRPDSKFYHYDS 200
            ...|..  ::..:|...:..:.:|.| ::.:|   |..|....|  ||||:|.|.||.:.|:|||
pombe    64 VFLLAEAAISPEELKVALPKKLMNCK-YLFMPINDLDKHAAGSGGSHWSLMVASIPDGQCYYYDS 127

  Fly   201 LDN-----CHSPLAASVSETLRAPLEAWKFALVTGRCLQQERQAAGKEGSGRDPASGIHLMCMTD 260
            |.|     |.|.| |.||:..:.     ||.:   .|:..::|..|.:       .|.|:...|.
pombe   128 LSNGKTKDCRSAL-ARVSDLFKK-----KFTI---ECMPVQQQRNGYD-------CGAHVCAFTL 176

  Fly   261 HVADYVARCGYATSS---LLIAVDQIAAMRTHLV----ELIQSLG 298
            .:...:......|||   |......:.|:|..|.    .:|.|||
pombe   177 ELVRRLLHSPMPTSSMWNLSTFQPDVTAIREQLSRCLDHIINSLG 221

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1503NP_001285511.1 Peptidase_C48 117..>205 CDD:304959 27/100 (27%)
nep1NP_596375.2 Peptidase_C48 27..217 CDD:304959 51/211 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003201
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46468
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.