DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1503 and SENP8

DIOPT Version :8

Sequence 1:NP_001285511.1 Gene:CG1503 / 33090 FlyBaseID:FBgn0031157 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_011519517.1 Gene:SENP8 / 123228 HGNCID:22992 Length:256 Species:Homo sapiens

Alignment Length:255 Identity:66/255 - (25%)
Similarity:112/255 - (43%) Gaps:31/255 - (12%)


  Fly    52 GKGKNKNKIRDSKTSTSLALERGSGDGPHQLAEVSLVALRFMDISLRHSDVQLLQSANEGVNERL 116
            |:||.|        |.||.........|.|. ::..|.|.:||..||.|||.||...: .:|:.:
Human    21 GRGKRK--------SMSLVQLLEFLSSPRQY-KMDPVVLSYMDSLLRQSDVSLLDPPS-WLNDHI 75

  Fly   117 VAFYYAYLQHRRYRSELD-LHFLNPGLAARLR-HMNMRQLWAMVRDRRLNEKQFILVPLSTHPRP 179
            :.|.:.|..:.::....| :.|::|.:...:: ..|..::...:....|..|:.:.:.::.:...
Human    76 IGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQ 140

  Fly   180 HG---HWSLLVISRPDSKFYHYDSLDNCHSPLAASVSETLRAPL--EAWKFALVTGRCLQQERQA 239
            ..   ||||||..:..:.|:||||....:|..|..|:|.|.|.|  :..|.|.|       |.:|
Human   141 AAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFV-------EEKA 198

  Fly   240 AGKEGSGRDPASGIHLMCMTDHVADYVARCGYATSSL--LIAVDQIAAMRTHLVELIQSL 297
            ..::.|   ...|::::|.|:.:.....|  ..|.||  |:....|...|....:||.:|
Human   199 PAQQNS---YDCGMYVICNTEALCQNFFR--QQTESLLQLLTPAYITKKRGEWKDLITTL 253

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1503NP_001285511.1 Peptidase_C48 117..>205 CDD:304959 19/92 (21%)
SENP8XP_011519517.1 Peptidase_C48 70..218 CDD:304959 36/157 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C150982050
eggNOG 1 0.900 E1_COG2828
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3849
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1313098at2759
OrthoFinder 1 1.000 FOG0003201
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR46468
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.