DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1503 and senp8

DIOPT Version :8

Sequence 1:NP_001285511.1 Gene:CG1503 / 33090 FlyBaseID:FBgn0031157 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001120583.1 Gene:senp8 / 100145737 XenbaseID:XB-GENE-959844 Length:215 Species:Xenopus tropicalis

Alignment Length:186 Identity:44/186 - (23%)
Similarity:85/186 - (45%) Gaps:27/186 - (14%)


  Fly    88 VALRFMDISLRHSDVQLLQSANEGVNERLVAFYYAYLQHRRYRSEL------DLHFLNPGLAARL 146
            |.:.|.|..||.|||.||...: .:|:.::.|.:.:|.     |.|      .:.||:|.::..:
 Frog     4 VVVSFGDALLRSSDVALLDPPH-WLNDNIIGFTFEFLS-----SSLPPLQAQQVSFLSPEVSQFI 62

  Fly   147 RHMNMRQLWAMVRDRRLNEKQFILVPLSTHPRPHG---HWSLLVISRPDSKFYHYDSLDNCHSPL 208
            :... .:....:....|..|:.:|:|::.:..|..   |||||...|..:.|.||||....::|.
 Frog    63 KCCG-NEASDFLEPLDLPSKELVLIPVNDNTGPEAGGTHWSLLAYVRRYTVFLHYDSSPGTNAPH 126

  Fly   209 AASVSETLRAPLEAWKFALVTGRCLQQERQAAGKEGSGRDPASGIHLMCMTDHVAD 264
            |..:::.|.        .|:.|:...:|..|..:..|   ...|::::|:.:.:::
 Frog   127 ARLMAKNLD--------VLLGGKQNYREEDAPVQHNS---YDCGMYVVCVAEALSE 171

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1503NP_001285511.1 Peptidase_C48 117..>205 CDD:304959 23/96 (24%)
senp8NP_001120583.1 Peptidase_C48 26..175 CDD:304959 34/163 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C150984776
eggNOG 1 0.900 E1_COG2828
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4585
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1313098at2759
OrthoFinder 1 1.000 FOG0003201
OrthoInspector 1 1.000 T129139
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.