DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stt3A and STT3B

DIOPT Version :8

Sequence 1:NP_001259751.2 Gene:Stt3A / 33082 FlyBaseID:FBgn0031149 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_174675.2 Gene:STT3B / 840312 AraportID:AT1G34130 Length:735 Species:Arabidopsis thaliana

Alignment Length:708 Identity:433/709 (61%)
Similarity:539/709 (76%) Gaps:22/709 (3%)


  Fly    17 KQEHLVKLAILILAAVLSFATRLFSVLRFESVIHEFDPYFNYRTTRFLAEQGFYKFHNWFDDRAW 81
            :||.|::::||.|..:|:|..|||||||:||:|||||||||||||.||.|:|||:|.||||..:|
plant    36 QQELLLRISILGLVYILAFIARLFSVLRYESMIHEFDPYFNYRTTLFLTEKGFYEFWNWFDSESW 100

  Fly    82 YPLGRIIGGTIYPGLMLTSAALYRLMWLLNVTIDIRNVCVFLAPFFSSLTTLVTYALTKEIHSTG 146
            ||||||||||:|||||:|:|.:|..:..|...:.||.|||..||||:|.||||.|...||:..||
plant   101 YPLGRIIGGTLYPGLMVTAALIYWTLRFLRFFVHIREVCVLTAPFFASNTTLVAYFFGKELWDTG 165

  Fly   147 AGLVAAALISIVPGYISRSVAGSYDNEGIAIFCMLFTYYLWIKAVKTGTIFWSAMSALAYFYMVS 211
            ||||||.||:|.|||||||||||||||.:|||.:|.|:||::|||.||::.|:..||..||||||
plant   166 AGLVAAVLIAICPGYISRSVAGSYDNEAVAIFALLLTFYLFVKAVNTGSLAWALASAFGYFYMVS 230

  Fly   212 SWGGYVFLINLIPLHVLALMITGRFSHRIYIAYSTLYCVGTILSMQISFVGFQPIQSSEHMLALG 276
            :||||||:|||:||:||.|:||||:|.|:||||:.:|.:|.:|:|||.|||||.:||.|||.|:|
plant   231 AWGGYVFIINLVPLYVLVLLITGRYSMRLYIAYNCMYILGMLLAMQIRFVGFQHVQSGEHMGAMG 295

  Fly   277 TFGLCQIHAFVDYLRSRIPKDHFDLLFKTLVSSVLTVVFVVGTLL----TLTGKVSPWTGRFYSL 337
            .|.|.|:..|:|:::.::   :...||:|.:...:|...:||.:.    |.:|.:||||||||||
plant   296 VFLLMQVFYFLDWVKYQL---NDTKLFQTFLRITVTSAILVGGVAVGVGTASGYISPWTGRFYSL 357

  Fly   338 LDPSYAKNHIPIIASVSEHQPTSWSSFYFDLQILVFLFPAGLYFCFSKLTDSNIFIILYGVTSIY 402
            |||:|||:||||||||||||||:||||.||..||:|||||||||||.:|||:.|||::||:||:|
plant   358 LDPTYAKDHIPIIASVSEHQPTAWSSFMFDYHILLFLFPAGLYFCFKRLTDATIFIVMYGLTSLY 422

  Fly   403 FAGVMVRLMLVLAPVMCVLSGIAIS-------HLLAKYIKSVDAGSSSKQGVESKRQHKKLEQQT 460
            ||||||||:||..|.:|::|.||:|       .||....|....||:...| .||...|....|:
plant   423 FAGVMVRLILVATPAVCLISAIAVSATIKNLTSLLRTKQKVSQTGSTKGAG-SSKASSKVTLDQS 486

  Fly   461 GGVKSEVAIGFVGVITLMLIVYTLHCTWVTSEAYSSPSIVLSARSHDGGRIIFDDFREAYYWLQM 525
            ...:...||..:..:..:|..|.:||||||:||||||||||:||...|.||||||:|||||||:.
plant   487 QPFQKNGAIALLVGVFYLLSRYAIHCTWVTAEAYSSPSIVLAARGAHGNRIIFDDYREAYYWLRQ 551

  Fly   526 NTPEDARIMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASSEEKAYEIMRELDVDYVL 590
            ||..||:||||||||||||||.|||::|||||||||||:.||:||:|.|:.||:|||.|||:|||
plant   552 NTATDAKIMSWWDYGYQITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDDAYDIMRSLDVNYVL 616

  Fly   591 VIFGGLTGYSSDDINKFLWMVRIGGSTDRGAH--IREKDYYAANGEFRVDKEGSPTLLNCLMYKM 653
            |:|||:|||||||||||||||||||    |..  |:|.| |..||||||||..||.:|||||||:
plant   617 VVFGGVTGYSSDDINKFLWMVRIGG----GVFPVIKEPD-YLVNGEFRVDKGASPKMLNCLMYKL 676

  Fly   654 CYYRFGQMYTEGGKAQGYDRVRAAEIGNKDFELDVMEEAYTTEHWLVRIYKVKDLPNR 711
            ||||||::.||.||..||||.|..||||||.:|:.:||||||.:|:||||:||...||
plant   677 CYYRFGELTTEYGKPPGYDRARGVEIGNKDIKLEHLEEAYTTSNWIVRIYRVKPPTNR 734

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Stt3ANP_001259751.2 Stt3 19..712 CDD:224206 432/707 (61%)
STT3 21..495 CDD:280649 277/485 (57%)
STT3BNP_174675.2 Stt3 28..733 CDD:224206 431/706 (61%)
STT3 40..521 CDD:280649 277/485 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H40617
Inparanoid 1 1.050 871 1.000 Inparanoid score I59
OMA 1 1.010
OrthoDB 1 1.010 D187775at2759
OrthoInspector 1 1.000 T192405
orthoMCL 1 0.900 OOG5_126840
Panther 1 1.100 O PTHR13872
Phylome 1 0.910 0.800 Consistency score
98.980

Return to query results.
Submit another query.