DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stt3A and Stt3b

DIOPT Version :8

Sequence 1:NP_001259751.2 Gene:Stt3A / 33082 FlyBaseID:FBgn0031149 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_077184.2 Gene:Stt3b / 68292 MGIID:1915542 Length:823 Species:Mus musculus

Alignment Length:726 Identity:430/727 (59%)
Similarity:533/727 (73%) Gaps:25/727 (3%)


  Fly     7 GVARGLLTWDKQEHLVKLAILILAAVLSFATRLFSVLRFESVIHEFDPYFNYRTTRFLAEQGFYK 71
            |::.||......:.|:...||.||.:..|::|||:|:||||:||||||:||||:|..||..|||:
Mouse    54 GLSGGLSQPAGWQSLLSFTILFLAWLAGFSSRLFAVIRFESIIHEFDPWFNYRSTHHLASHGFYE 118

  Fly    72 FHNWFDDRAWYPLGRIIGGTIYPGLMLTSAALYRLMWLLNVTIDIRNVCVFLAPFFSSLTTLVTY 136
            |.||||:|||||||||:|||:|||||:|:..::.::..||:|:.||:|||||||.||.||::.|:
Mouse   119 FLNWFDERAWYPLGRIVGGTVYPGLMITAGLIHWILNTLNITVHIRDVCVFLAPTFSGLTSISTF 183

  Fly   137 ALTKEIHSTGAGLVAAALISIVPGYISRSVAGSYDNEGIAIFCMLFTYYLWIKAVKTGTIFWSAM 201
            .||:|:.:.||||:||..|:|||||||||||||:||||||||.:.||||||:|:||||::||:..
Mouse   184 LLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWTMC 248

  Fly   202 SALAYFYMVSSWGGYVFLINLIPLHVLALMITGRFSHRIYIAYSTLYCVGTILSMQISFVGFQPI 266
            ..|:||||||:||||||:||||||||..|::..|:|.|:||||||.|.||.||||||.|||||||
Mouse   249 CCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSKRVYIAYSTFYIVGLILSMQIPFVGFQPI 313

  Fly   267 QSSEHMLALGTFGLCQIHAFVDYLRSRIPKDHFDLLFKTLVSSVLTVVFVVGTLLTLTGKVSPWT 331
            ::||||.|.|.|.|.|.:||:.|||.|:.|..|..||...||.....||:....||.||.::||:
Mouse   314 RTSEHMAAAGVFALLQAYAFLQYLRDRLTKQEFQTLFFLGVSLAAGAVFLSVIYLTYTGYIAPWS 378

  Fly   332 GRFYSLLDPSYAKNHIPIIASVSEHQPTSWSSFYFDLQILVFLFPAGLYFCFSKLTDSNIFIILY 396
            ||||||.|..|||.||||||||||||||:|.||:|||.|||..|||||:||...:.|..:|:.||
Mouse   379 GRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFVALY 443

  Fly   397 GVTSIYFAGVMVRLMLVLAPVMCVLSGIAISHLLAKYI----KSVDAGSSSKQGVESKRQHKKLE 457
            .::::|||||||||||.|.||:|:||.||.|::...|:    |..:.........:.||....|.
Mouse   444 AISAVYFAGVMVRLMLTLTPVVCMLSAIAFSNVFEHYLGDDMKRENPPVEDSSDEDDKRNPGNLY 508

  Fly   458 QQTGGV--------KSEVAIG-----FVGVITLMLI-VYTLHCTWVTSEAYSSPSIVLSARSHDG 508
            .:.|.|        |.|..:|     .|.::.|||: ::.:|||||||.||||||:||::.:|||
Mouse   509 DKAGKVRKHVTEQEKPEEGLGPNIKSIVTMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDG 573

  Fly   509 GRIIFDDFREAYYWLQMNTPEDARIMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASS 573
            .|.|.|||||||:||:.||.|.||:||||||||||..|||||.|||||||||:||:.||:||:|:
Mouse   574 TRNILDDFREAYFWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSN 638

  Fly   574 EEKAYEIMRELDVDYVLVIFGGLTGYSSDDINKFLWMVRIGGSTDRGAH---IREKDYYAANGEF 635
            |..||:|||.||||||||||||:.|||.||||||||||||.    .|.|   |||.||:...|||
Mouse   639 ETAAYKIMRSLDVDYVLVIFGGVIGYSGDDINKFLWMVRIA----EGEHPKDIREGDYFTQQGEF 699

  Fly   636 RVDKEGSPTLLNCLMYKMCYYRFGQMYTEGGKAQGYDRVRAAEIGNKDFELDVMEEAYTTEHWLV 700
            ||||.|||||||||||||.|||||:|..:.....|:||.|.|||||||.:...:|||:|:|||||
Mouse   700 RVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEHWLV 764

  Fly   701 RIYKVKDLPNR 711
            ||||||...||
Mouse   765 RIYKVKAPDNR 775

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Stt3ANP_001259751.2 Stt3 19..712 CDD:224206 427/715 (60%)
STT3 21..495 CDD:280649 277/492 (56%)
Stt3bNP_077184.2 STT3 68..560 CDD:280649 277/492 (56%)
DXD motif 1. {ECO:0000250|UniProtKB:Q5HTX9} 98..100 2/2 (100%)
DXD motif 2. {ECO:0000250|UniProtKB:P39007} 218..220 2/2 (100%)
SVSE motif. {ECO:0000250|UniProtKB:Q5HTX9} 399..402 3/3 (100%)
WWDYG motif. {ECO:0000250|UniProtKB:P39007} 601..605 4/4 (100%)
Target acceptor peptide binding. {ECO:0000250|UniProtKB:B9KDD4} 601..603 2/2 (100%)
DK motif. {ECO:0000250|UniProtKB:P39007} 668..675 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001537
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126840
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1409
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.