DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stt3A and stt3a

DIOPT Version :8

Sequence 1:NP_001259751.2 Gene:Stt3A / 33082 FlyBaseID:FBgn0031149 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001001202.1 Gene:stt3a / 407861 XenbaseID:XB-GENE-973638 Length:705 Species:Xenopus tropicalis

Alignment Length:701 Identity:541/702 (77%)
Similarity:616/702 (88%) Gaps:7/702 (1%)


  Fly    13 LTWDKQEHLVKLAILILAAVLSFATRLFSVLRFESVIHEFDPYFNYRTTRFLAEQGFYKFHNWFD 77
            |:::||:.|:||.||.:||:|||:||||||||||||||||||||||||||||||:|||.||||||
 Frog     9 LSYEKQDTLLKLLILSMAAILSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYNFHNWFD 73

  Fly    78 DRAWYPLGRIIGGTIYPGLMLTSAALYRLMWLLNVTIDIRNVCVFLAPFFSSLTTLVTYALTKEI 142
            ||||||||||||||||||||:||||.|.::...::|||||||||||||.|||.||:|||.||||:
 Frog    74 DRAWYPLGRIIGGTIYPGLMITSAAFYHILHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTKEL 138

  Fly   143 HSTGAGLVAAALISIVPGYISRSVAGSYDNEGIAIFCMLFTYYLWIKAVKTGTIFWSAMSALAYF 207
            ...||||:|||:|::||||||||||||||||||||||||.|||:||||||||:|:|:||.|||||
 Frog   139 KDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAAMCALAYF 203

  Fly   208 YMVSSWGGYVFLINLIPLHVLALMITGRFSHRIYIAYSTLYCVGTILSMQISFVGFQPIQSSEHM 272
            |||||||||||||||||||||.||:|||||||||:||.|:||:|||||||||||||||:.|||||
 Frog   204 YMVSSWGGYVFLINLIPLHVLVLMLTGRFSHRIYVAYCTVYCLGTILSMQISFVGFQPVLSSEHM 268

  Fly   273 LALGTFGLCQIHAFVDYLRSRIPKDHFDLLFKTLVSSVLTVVFVVGTLLTLTGKVSPWTGRFYSL 337
            .|||.|||||||||||||||::....|::||::::|.|..|:..||.:|.||||:||||||||||
 Frog   269 AALGVFGLCQIHAFVDYLRSKLNPQQFEILFRSVISLVGFVLLTVGAVLMLTGKISPWTGRFYSL 333

  Fly   338 LDPSYAKNHIPIIASVSEHQPTSWSSFYFDLQILVFLFPAGLYFCFSKLTDSNIFIILYGVTSIY 402
            ||||||||:|||||||||||||:|||:|||||:|||:||.|||:|||.|:|:.||||:|||||:|
 Frog   334 LDPSYAKNNIPIIASVSEHQPTTWSSYYFDLQLLVFMFPVGLYYCFSNLSDARIFIIMYGVTSMY 398

  Fly   403 FAGVMVRLMLVLAPVMCVLSGIAISHLLAKYIKSVDAGSSSKQGVESKRQHKKLEQQTGGVKSEV 467
            |:.||||||||||||||:||||.:|.:|:.|:|::|.....|       :.||.:..|..:|:||
 Frog   399 FSAVMVRLMLVLAPVMCILSGIGVSQVLSTYMKNLDISRPDK-------KTKKQQDSTYPIKNEV 456

  Fly   468 AIGFVGVITLMLIVYTLHCTWVTSEAYSSPSIVLSARSHDGGRIIFDDFREAYYWLQMNTPEDAR 532
            |.|.:.|:...|:.||.|.||||||||||||||||||..||.||||||||||||||:.||||||:
 Frog   457 ASGMILVMAFFLVTYTFHSTWVTSEAYSSPSIVLSARGGDGSRIIFDDFREAYYWLRHNTPEDAK 521

  Fly   533 IMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASSEEKAYEIMRELDVDYVLVIFGGLT 597
            :|||||||||||||||||||||||||||||||||||||||:|||||||||||||.||||||||||
 Frog   522 VMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASTEEKAYEIMRELDVSYVLVIFGGLT 586

  Fly   598 GYSSDDINKFLWMVRIGGSTDRGAHIREKDYYAANGEFRVDKEGSPTLLNCLMYKMCYYRFGQMY 662
            |||||||||||||||||||||.|.||:|.|||...||||||:||||.||||||||||||||||:|
 Frog   587 GYSSDDINKFLWMVRIGGSTDTGKHIKEHDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVY 651

  Fly   663 TEGGKAQGYDRVRAAEIGNKDFELDVMEEAYTTEHWLVRIYKVKDLPNRGV 713
            ||..:..||||||.||||||||||||:|||||||||||||||||||.|||:
 Frog   652 TEAKRPPGYDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRGL 702

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Stt3ANP_001259751.2 Stt3 19..712 CDD:224206 537/693 (77%)
STT3 21..495 CDD:280649 347/474 (73%)
stt3aNP_001001202.1 STT3 17..484 CDD:280649 347/474 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C153564995
eggNOG 1 0.900 E1_COG1287
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H40617
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D111618at33208
OrthoFinder 1 1.000 FOG0001537
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1409
TreeFam 1 0.960
98.750

Return to query results.
Submit another query.